BLASTX nr result
ID: Paeonia24_contig00018108
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00018108 (304 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007201498.1| hypothetical protein PRUPE_ppa016731mg [Prun... 56 6e-06 >ref|XP_007201498.1| hypothetical protein PRUPE_ppa016731mg [Prunus persica] gi|462396898|gb|EMJ02697.1| hypothetical protein PRUPE_ppa016731mg [Prunus persica] Length = 528 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +2 Query: 2 KVEPPSVSETPQVWAEALRIESGDVYALPYVIPY 103 KV P + TPQVWAEA++IES DVYALPYVIPY Sbjct: 495 KVGSPEIEMTPQVWAEAMQIESVDVYALPYVIPY 528