BLASTX nr result
ID: Paeonia24_contig00017902
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00017902 (312 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007029023.1| Emb:CAB82953.1, putative [Theobroma cacao] g... 59 9e-07 >ref|XP_007029023.1| Emb:CAB82953.1, putative [Theobroma cacao] gi|508717628|gb|EOY09525.1| Emb:CAB82953.1, putative [Theobroma cacao] Length = 650 Score = 58.5 bits (140), Expect = 9e-07 Identities = 40/103 (38%), Positives = 50/103 (48%), Gaps = 2/103 (1%) Frame = -3 Query: 310 KNQTNGHVLKTNQTTIPAPVPPVVKNQTNGHVLKTNQTTFRAPAAKNQTNGQVLKTNGTT 131 KN T VL NQTT+ P PV KN +T+ + +N QVLK N TT Sbjct: 162 KNNTQSLVLHANQTTLSPP--PVYKNPP--------RTSSQTEKKENSDKAQVLKANQTT 211 Query: 130 --TRAPEIPANQSSTLPTNSTLVEKKKSGKEQKNGLEKGVAEN 8 T + ANQS+ P S V K SGK +K+ +KGV N Sbjct: 212 IVTEKAPVAANQSTNSPAKSDSVNKVSSGKGEKSVAQKGVVSN 254