BLASTX nr result
ID: Paeonia24_contig00017037
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00017037 (282 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU37946.1| hypothetical protein MIMGU_mgv1a011787mg [Mimulus... 60 4e-07 ref|XP_006383086.1| hypothetical protein POPTR_0005s11410g [Popu... 60 4e-07 ref|XP_006383085.1| hypothetical protein POPTR_0005s11410g [Popu... 60 4e-07 gb|AAS19475.1| MYB1 [Tradescantia fluminensis] 60 4e-07 gb|EXC01078.1| Transcription factor [Morus notabilis] 59 5e-07 gb|EXB39302.1| Myb-related protein 308 [Morus notabilis] 59 5e-07 ref|NP_195574.1| transcription repressor MYB4 [Arabidopsis thali... 59 5e-07 gb|AHG99473.1| MYB16 [Malus hybrid cultivar] 59 5e-07 ref|XP_006663259.1| PREDICTED: myb-related protein 330-like [Ory... 59 5e-07 ref|XP_006660900.1| PREDICTED: myb-related protein Hv1-like [Ory... 59 5e-07 gb|ADT91707.1| MYB transcription factor [Gossypium hirsutum] 59 5e-07 ref|XP_006466200.1| PREDICTED: myb-related protein 330-like [Cit... 59 5e-07 ref|XP_006359691.1| PREDICTED: myb-related protein 308-like [Sol... 59 5e-07 gb|AHB59595.1| putative R2R3 MYB protein 7 [Arachis hypogaea] 59 5e-07 gb|AHB17741.1| MYB1 [Actinidia chinensis] 59 5e-07 ref|XP_007137351.1| hypothetical protein PHAVU_009G119900g [Phas... 59 5e-07 ref|XP_007131703.1| hypothetical protein PHAVU_011G034900g [Phas... 59 5e-07 ref|XP_006426418.1| hypothetical protein CICLE_v10026112mg [Citr... 59 5e-07 ref|XP_006384572.1| hypothetical protein POPTR_0004s18020g [Popu... 59 5e-07 ref|XP_006856762.1| hypothetical protein AMTR_s00055p00057500 [A... 59 5e-07 >gb|EYU37946.1| hypothetical protein MIMGU_mgv1a011787mg [Mimulus guttatus] Length = 271 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +3 Query: 186 TAKLLWCGKSYKLRWINYLRPDLKRGNFTEEE 281 +A LL CGKS +LRWINYLRPDLKRGNFTEEE Sbjct: 43 SAGLLRCGKSCRLRWINYLRPDLKRGNFTEEE 74 >ref|XP_006383086.1| hypothetical protein POPTR_0005s11410g [Populus trichocarpa] gi|550338663|gb|ERP60883.1| hypothetical protein POPTR_0005s11410g [Populus trichocarpa] Length = 254 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +3 Query: 186 TAKLLWCGKSYKLRWINYLRPDLKRGNFTEEE 281 +A LL CGKS +LRWINYLRPDLKRGNFTEEE Sbjct: 43 SAGLLRCGKSCRLRWINYLRPDLKRGNFTEEE 74 >ref|XP_006383085.1| hypothetical protein POPTR_0005s11410g [Populus trichocarpa] gi|550338662|gb|ERP60882.1| hypothetical protein POPTR_0005s11410g [Populus trichocarpa] Length = 245 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +3 Query: 186 TAKLLWCGKSYKLRWINYLRPDLKRGNFTEEE 281 +A LL CGKS +LRWINYLRPDLKRGNFTEEE Sbjct: 43 SAGLLRCGKSCRLRWINYLRPDLKRGNFTEEE 74 >gb|AAS19475.1| MYB1 [Tradescantia fluminensis] Length = 270 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +3 Query: 186 TAKLLWCGKSYKLRWINYLRPDLKRGNFTEEE 281 +A LL CGKS +LRWINYLRPDLKRGNFTEEE Sbjct: 43 SAGLLRCGKSCRLRWINYLRPDLKRGNFTEEE 74 >gb|EXC01078.1| Transcription factor [Morus notabilis] Length = 305 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 189 AKLLWCGKSYKLRWINYLRPDLKRGNFTEEE 281 A LL CGKS +LRWINYLRPDLKRGNFTEEE Sbjct: 44 AGLLRCGKSCRLRWINYLRPDLKRGNFTEEE 74 >gb|EXB39302.1| Myb-related protein 308 [Morus notabilis] Length = 261 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 189 AKLLWCGKSYKLRWINYLRPDLKRGNFTEEE 281 A LL CGKS +LRWINYLRPDLKRGNFTEEE Sbjct: 44 AGLLRCGKSCRLRWINYLRPDLKRGNFTEEE 74 >ref|NP_195574.1| transcription repressor MYB4 [Arabidopsis thaliana] gi|56749359|sp|Q9SZP1.1|MYB4_ARATH RecName: Full=Transcription repressor MYB4; AltName: Full=Myb-related protein 4; Short=AtMYB4 gi|4467149|emb|CAB37518.1| putative transcription factor (MYB4) [Arabidopsis thaliana] gi|7270845|emb|CAB80526.1| putative transcription factor (MYB4) [Arabidopsis thaliana] gi|17979197|gb|AAL49837.1| putative transcription factor MYB4 [Arabidopsis thaliana] gi|21689787|gb|AAM67537.1| putative transcription factor MYB4 [Arabidopsis thaliana] gi|22655176|gb|AAM98178.1| putative transcription factor MYB4 [Arabidopsis thaliana] gi|30023754|gb|AAP13410.1| At4g38620 [Arabidopsis thaliana] gi|41619362|gb|AAS10085.1| MYB transcription factor [Arabidopsis thaliana] gi|332661555|gb|AEE86955.1| transcription repressor MYB4 [Arabidopsis thaliana] Length = 282 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 189 AKLLWCGKSYKLRWINYLRPDLKRGNFTEEE 281 A LL CGKS +LRWINYLRPDLKRGNFTEEE Sbjct: 44 AGLLRCGKSCRLRWINYLRPDLKRGNFTEEE 74 >gb|AHG99473.1| MYB16 [Malus hybrid cultivar] Length = 255 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 189 AKLLWCGKSYKLRWINYLRPDLKRGNFTEEE 281 A LL CGKS +LRWINYLRPDLKRGNFTEEE Sbjct: 44 AGLLRCGKSCRLRWINYLRPDLKRGNFTEEE 74 >ref|XP_006663259.1| PREDICTED: myb-related protein 330-like [Oryza brachyantha] Length = 256 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 189 AKLLWCGKSYKLRWINYLRPDLKRGNFTEEE 281 A LL CGKS +LRWINYLRPDLKRGNFTEEE Sbjct: 44 AGLLRCGKSCRLRWINYLRPDLKRGNFTEEE 74 >ref|XP_006660900.1| PREDICTED: myb-related protein Hv1-like [Oryza brachyantha] Length = 248 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 189 AKLLWCGKSYKLRWINYLRPDLKRGNFTEEE 281 A LL CGKS +LRWINYLRPDLKRGNFTEEE Sbjct: 44 AGLLRCGKSCRLRWINYLRPDLKRGNFTEEE 74 >gb|ADT91707.1| MYB transcription factor [Gossypium hirsutum] Length = 257 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 189 AKLLWCGKSYKLRWINYLRPDLKRGNFTEEE 281 A LL CGKS +LRWINYLRPDLKRGNFTEEE Sbjct: 44 AGLLRCGKSCRLRWINYLRPDLKRGNFTEEE 74 >ref|XP_006466200.1| PREDICTED: myb-related protein 330-like [Citrus sinensis] Length = 315 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 189 AKLLWCGKSYKLRWINYLRPDLKRGNFTEEE 281 A LL CGKS +LRWINYLRPDLKRGNFTEEE Sbjct: 44 AGLLRCGKSCRLRWINYLRPDLKRGNFTEEE 74 >ref|XP_006359691.1| PREDICTED: myb-related protein 308-like [Solanum tuberosum] Length = 254 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 189 AKLLWCGKSYKLRWINYLRPDLKRGNFTEEE 281 A LL CGKS +LRWINYLRPDLKRGNFTEEE Sbjct: 44 AGLLRCGKSCRLRWINYLRPDLKRGNFTEEE 74 >gb|AHB59595.1| putative R2R3 MYB protein 7 [Arachis hypogaea] Length = 317 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 189 AKLLWCGKSYKLRWINYLRPDLKRGNFTEEE 281 A LL CGKS +LRWINYLRPDLKRGNFTEEE Sbjct: 44 AGLLRCGKSCRLRWINYLRPDLKRGNFTEEE 74 >gb|AHB17741.1| MYB1 [Actinidia chinensis] Length = 260 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 189 AKLLWCGKSYKLRWINYLRPDLKRGNFTEEE 281 A LL CGKS +LRWINYLRPDLKRGNFTEEE Sbjct: 44 AGLLRCGKSCRLRWINYLRPDLKRGNFTEEE 74 >ref|XP_007137351.1| hypothetical protein PHAVU_009G119900g [Phaseolus vulgaris] gi|561010438|gb|ESW09345.1| hypothetical protein PHAVU_009G119900g [Phaseolus vulgaris] Length = 259 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 189 AKLLWCGKSYKLRWINYLRPDLKRGNFTEEE 281 A LL CGKS +LRWINYLRPDLKRGNFTEEE Sbjct: 44 AGLLRCGKSCRLRWINYLRPDLKRGNFTEEE 74 >ref|XP_007131703.1| hypothetical protein PHAVU_011G034900g [Phaseolus vulgaris] gi|561004703|gb|ESW03697.1| hypothetical protein PHAVU_011G034900g [Phaseolus vulgaris] Length = 253 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 189 AKLLWCGKSYKLRWINYLRPDLKRGNFTEEE 281 A LL CGKS +LRWINYLRPDLKRGNFTEEE Sbjct: 44 AGLLRCGKSCRLRWINYLRPDLKRGNFTEEE 74 >ref|XP_006426418.1| hypothetical protein CICLE_v10026112mg [Citrus clementina] gi|557528408|gb|ESR39658.1| hypothetical protein CICLE_v10026112mg [Citrus clementina] Length = 316 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 189 AKLLWCGKSYKLRWINYLRPDLKRGNFTEEE 281 A LL CGKS +LRWINYLRPDLKRGNFTEEE Sbjct: 44 AGLLRCGKSCRLRWINYLRPDLKRGNFTEEE 74 >ref|XP_006384572.1| hypothetical protein POPTR_0004s18020g [Populus trichocarpa] gi|550341290|gb|ERP62369.1| hypothetical protein POPTR_0004s18020g [Populus trichocarpa] Length = 266 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 189 AKLLWCGKSYKLRWINYLRPDLKRGNFTEEE 281 A LL CGKS +LRWINYLRPDLKRGNFTEEE Sbjct: 44 AGLLRCGKSCRLRWINYLRPDLKRGNFTEEE 74 >ref|XP_006856762.1| hypothetical protein AMTR_s00055p00057500 [Amborella trichopoda] gi|548860696|gb|ERN18229.1| hypothetical protein AMTR_s00055p00057500 [Amborella trichopoda] Length = 233 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 189 AKLLWCGKSYKLRWINYLRPDLKRGNFTEEE 281 A LL CGKS +LRWINYLRPDLKRGNFTEEE Sbjct: 44 AGLLRCGKSCRLRWINYLRPDLKRGNFTEEE 74