BLASTX nr result
ID: Paeonia24_contig00016988
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00016988 (278 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007018106.1| Localized to the inner membrane of the chlor... 58 2e-06 >ref|XP_007018106.1| Localized to the inner membrane of the chloroplast [Theobroma cacao] gi|508723434|gb|EOY15331.1| Localized to the inner membrane of the chloroplast [Theobroma cacao] Length = 170 Score = 57.8 bits (138), Expect = 2e-06 Identities = 34/66 (51%), Positives = 43/66 (65%), Gaps = 8/66 (12%) Frame = +1 Query: 103 MTTMSNSLCLTRNTGIQISP------VDQRFGSVGPSNLFVSPSRKGK--VSTSKRSLAV 258 MT++SNSL L +N GIQ+S DQ FGS P+NL + +R GK +S S+R L V Sbjct: 1 MTSLSNSLVLPKNRGIQLSSGSHLKAADQSFGSASPTNLSFNSNRVGKLQLSVSRRPLIV 60 Query: 259 QASYSD 276 QASYSD Sbjct: 61 QASYSD 66