BLASTX nr result
ID: Paeonia24_contig00016775
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00016775 (1447 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAM55794.1| PsbE [Porana velutina] 76 4e-11 ref|XP_006404486.1| hypothetical protein EUTSA_v10011089mg, part... 75 7e-11 ref|NP_084815.1| photosystem II protein V [Lotus japonicus] gi|9... 75 7e-11 ref|YP_003587768.1| photosystem II cytochrome b-559 alpha subuni... 75 7e-11 gb|ADZ93677.1| cytochrome b-559 alpha subunit [Georgeantha hexan... 75 7e-11 gb|AFA27510.1| photosystem II cytochrome b559 alpha subunit, par... 75 7e-11 ref|YP_007476064.1| photosystem II cytochrome b559 alpha subunit... 75 7e-11 ref|YP_005088824.1| photosystem II protein V (chloroplast) [Mill... 75 7e-11 ref|XP_003606015.1| Cytochrome b559 subunit alpha [Medicago trun... 75 7e-11 ref|XP_003605589.1| Cytochrome b559 subunit alpha [Medicago trun... 75 7e-11 dbj|BAL03646.1| cytochrome b559 alpha chain (chloroplast) [Bowen... 75 7e-11 ref|YP_003795528.1| cytochrome b559 alpha subunit of photosystem... 75 7e-11 ref|YP_001381711.1| photosystem II cytochrome b559 alpha subunit... 75 7e-11 ref|YP_001122824.1| photosystem II cytochrome b559 alpha subunit... 75 7e-11 gb|AAN32324.1| cytochrome b-559 alpha subunit, partial (chloropl... 75 7e-11 gb|AAN32428.1| cytochrome b-559 alpha subunit, partial (chloropl... 75 7e-11 gb|AAQ05220.1| cytochrome b-559 alpha subunit [Bowenia serrulata... 75 7e-11 gb|AAQ05236.1| cytochrome b-559 alpha subunit, partial (chloropl... 75 7e-11 gb|AAM55641.1| PsbE [Merremia hastata] 75 7e-11 ref|YP_006665797.1| photosystem II cytochrome b559 alpha subunit... 75 1e-10 >gb|AAM55794.1| PsbE [Porana velutina] Length = 82 Score = 75.9 bits (185), Expect = 4e-11 Identities = 35/51 (68%), Positives = 41/51 (80%), Gaps = 2/51 (3%) Frame = +1 Query: 136 TTISSDANSIRYWIIHSITIPTLFIAGWLLVST--CYNMFGSPRPNEYFIE 282 T+ + SIRYW+IHSITIP+LFIAGWL VST Y++FGSPRPNEYF E Sbjct: 7 TSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTE 57 >ref|XP_006404486.1| hypothetical protein EUTSA_v10011089mg, partial [Eutrema salsugineum] gi|557105605|gb|ESQ45939.1| hypothetical protein EUTSA_v10011089mg, partial [Eutrema salsugineum] Length = 94 Score = 75.1 bits (183), Expect = 7e-11 Identities = 39/68 (57%), Positives = 46/68 (67%), Gaps = 11/68 (16%) Frame = +1 Query: 112 DSLLEQIATTISSDAN---------SIRYWIIHSITIPTLFIAGWLLVST--CYNMFGSP 258 DSL E + ++S SIRYW+IHSITIP+LFIAGWL VST Y++FGSP Sbjct: 2 DSLREYLEFSMSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSP 61 Query: 259 RPNEYFIE 282 RPNEYF E Sbjct: 62 RPNEYFTE 69 >ref|NP_084815.1| photosystem II protein V [Lotus japonicus] gi|91214159|ref|YP_538781.1| photosystem II protein V [Glycine max] gi|520850600|ref|YP_008145360.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Glycine tomentella] gi|526175909|ref|YP_008145727.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Glycine cyrtoloba] gi|526175996|ref|YP_008145808.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Glycine stenophita] gi|526176080|ref|YP_008145890.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Glycine canescens] gi|526176167|ref|YP_008145972.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Glycine dolichocarpa] gi|526176254|ref|YP_008146054.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Glycine falcata] gi|526176348|ref|YP_008146136.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Glycine syndetika] gi|558604153|ref|YP_008816263.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Glycine soja] gi|568244834|ref|YP_008963618.1| photosystem II protein V (chloroplast) [Lupinus luteus] gi|23821993|sp|Q9BBR5.3|PSBE_LOTJA RecName: Full=Cytochrome b559 subunit alpha; AltName: Full=PSII reaction center subunit V gi|94730464|sp|Q2PMR7.1|PSBE_SOYBN RecName: Full=Cytochrome b559 subunit alpha; AltName: Full=PSII reaction center subunit V gi|13358996|dbj|BAB33213.1| PSII cytochrome b559 [Lotus japonicus] gi|83595760|gb|ABC25141.1| photosystem II cytochrome b559 alpha subunit [Glycine max] gi|485474329|gb|AGK82931.1| photosystem II protein V (chloroplast) [Lupinus luteus] gi|507588298|gb|AGM51189.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Glycine soja] gi|514252915|gb|AGO44176.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Glycine cyrtoloba] gi|514252997|gb|AGO44257.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Glycine tomentella] gi|514253080|gb|AGO44339.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Glycine stenophita] gi|514253163|gb|AGO44421.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Glycine canescens] gi|514253246|gb|AGO44503.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Glycine dolichocarpa] gi|514253329|gb|AGO44585.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Glycine falcata] gi|514253412|gb|AGO44667.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Glycine syndetika] gi|514253493|gb|AGO44747.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Glycine tomentella] gi|514253572|gb|AGO44825.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Glycine tomentella] gi|557469745|gb|AHA03998.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Glycine soja] Length = 83 Score = 75.1 bits (183), Expect = 7e-11 Identities = 35/43 (81%), Positives = 38/43 (88%), Gaps = 2/43 (4%) Frame = +1 Query: 160 SIRYWIIHSITIPTLFIAGWLLVST--CYNMFGSPRPNEYFIE 282 SIRYWIIHSITIP+LFIAGWL VST Y++FGSPRPNEYF E Sbjct: 16 SIRYWIIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTE 58 >ref|YP_003587768.1| photosystem II cytochrome b-559 alpha subunit [Lathyrus sativus] gi|295137004|ref|YP_003587551.1| photosystem II cytochrome b-559 alpha subunit [Pisum sativum] gi|131306|sp|P13554.3|PSBE_PEA RecName: Full=Cytochrome b559 subunit alpha; AltName: Full=PSII reaction center subunit V gi|12153|emb|CAA33772.1| unnamed protein product [Pisum sativum] gi|293338576|gb|ADE43549.1| photosystem II cytochrome b-559 alpha subunit (chloroplast) [Pisum sativum] gi|293338657|gb|ADE43629.1| photosystem II cytochrome b-559 alpha subunit (chloroplast) [Lathyrus sativus] Length = 83 Score = 75.1 bits (183), Expect = 7e-11 Identities = 35/43 (81%), Positives = 38/43 (88%), Gaps = 2/43 (4%) Frame = +1 Query: 160 SIRYWIIHSITIPTLFIAGWLLVST--CYNMFGSPRPNEYFIE 282 SIRYWIIHSITIP+LFIAGWL VST Y++FGSPRPNEYF E Sbjct: 16 SIRYWIIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTE 58 >gb|ADZ93677.1| cytochrome b-559 alpha subunit [Georgeantha hexandra] Length = 75 Score = 75.1 bits (183), Expect = 7e-11 Identities = 35/43 (81%), Positives = 38/43 (88%), Gaps = 2/43 (4%) Frame = +1 Query: 160 SIRYWIIHSITIPTLFIAGWLLVST--CYNMFGSPRPNEYFIE 282 SIRYWIIHSITIP+LFIAGWL VST Y++FGSPRPNEYF E Sbjct: 8 SIRYWIIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTE 50 >gb|AFA27510.1| photosystem II cytochrome b559 alpha subunit, partial [Georgeantha hexandra] Length = 83 Score = 75.1 bits (183), Expect = 7e-11 Identities = 35/43 (81%), Positives = 38/43 (88%), Gaps = 2/43 (4%) Frame = +1 Query: 160 SIRYWIIHSITIPTLFIAGWLLVST--CYNMFGSPRPNEYFIE 282 SIRYWIIHSITIP+LFIAGWL VST Y++FGSPRPNEYF E Sbjct: 16 SIRYWIIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTE 58 >ref|YP_007476064.1| photosystem II cytochrome b559 alpha subunit [Dasypogon bromeliifolius] gi|374974827|gb|AFA27505.1| photosystem II cytochrome b559 alpha subunit [Dasypogon bromeliifolius] gi|449326548|gb|AGE93129.1| photosystem II cytochrome b559 alpha subunit [Dasypogon bromeliifolius] Length = 83 Score = 75.1 bits (183), Expect = 7e-11 Identities = 35/43 (81%), Positives = 38/43 (88%), Gaps = 2/43 (4%) Frame = +1 Query: 160 SIRYWIIHSITIPTLFIAGWLLVST--CYNMFGSPRPNEYFIE 282 SIRYWIIHSITIP+LFIAGWL VST Y++FGSPRPNEYF E Sbjct: 16 SIRYWIIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTE 58 >ref|YP_005088824.1| photosystem II protein V (chloroplast) [Millettia pinnata] gi|356474843|gb|AET11361.1| photosystem II protein V (chloroplast) [Millettia pinnata] Length = 83 Score = 75.1 bits (183), Expect = 7e-11 Identities = 35/43 (81%), Positives = 38/43 (88%), Gaps = 2/43 (4%) Frame = +1 Query: 160 SIRYWIIHSITIPTLFIAGWLLVST--CYNMFGSPRPNEYFIE 282 SIRYWIIHSITIP+LFIAGWL VST Y++FGSPRPNEYF E Sbjct: 16 SIRYWIIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTE 58 >ref|XP_003606015.1| Cytochrome b559 subunit alpha [Medicago truncatula] gi|355507070|gb|AES88212.1| Cytochrome b559 subunit alpha [Medicago truncatula] Length = 136 Score = 75.1 bits (183), Expect = 7e-11 Identities = 35/43 (81%), Positives = 38/43 (88%), Gaps = 2/43 (4%) Frame = +1 Query: 160 SIRYWIIHSITIPTLFIAGWLLVST--CYNMFGSPRPNEYFIE 282 SIRYWIIHSITIP+LFIAGWL VST Y++FGSPRPNEYF E Sbjct: 16 SIRYWIIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTE 58 >ref|XP_003605589.1| Cytochrome b559 subunit alpha [Medicago truncatula] gi|355506644|gb|AES87786.1| Cytochrome b559 subunit alpha [Medicago truncatula] Length = 153 Score = 75.1 bits (183), Expect = 7e-11 Identities = 35/43 (81%), Positives = 38/43 (88%), Gaps = 2/43 (4%) Frame = +1 Query: 160 SIRYWIIHSITIPTLFIAGWLLVST--CYNMFGSPRPNEYFIE 282 SIRYWIIHSITIP+LFIAGWL VST Y++FGSPRPNEYF E Sbjct: 16 SIRYWIIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTE 58 >dbj|BAL03646.1| cytochrome b559 alpha chain (chloroplast) [Bowenia serrulata] Length = 83 Score = 75.1 bits (183), Expect = 7e-11 Identities = 35/43 (81%), Positives = 38/43 (88%), Gaps = 2/43 (4%) Frame = +1 Query: 160 SIRYWIIHSITIPTLFIAGWLLVST--CYNMFGSPRPNEYFIE 282 SIRYWIIHSITIP+LFIAGWL VST Y++FGSPRPNEYF E Sbjct: 16 SIRYWIIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTE 58 >ref|YP_003795528.1| cytochrome b559 alpha subunit of photosystem II [Floydiella terrestris] gi|270048189|gb|ACZ58484.1| cytochrome b559 alpha subunit of photosystem II [Floydiella terrestris] Length = 81 Score = 75.1 bits (183), Expect = 7e-11 Identities = 38/61 (62%), Positives = 43/61 (70%), Gaps = 2/61 (3%) Frame = +1 Query: 106 PNDSLLEQIATTISSDANSIRYWIIHSITIPTLFIAGWLLVST--CYNMFGSPRPNEYFI 279 PN+ I T SIRYW+IHSITIP+LFIAGWL VST Y++FGSPRPNEYF Sbjct: 5 PNERPFSDIIT-------SIRYWVIHSITIPSLFIAGWLFVSTGLAYDIFGSPRPNEYFT 57 Query: 280 E 282 E Sbjct: 58 E 58 >ref|YP_001381711.1| photosystem II cytochrome b559 alpha subunit [Medicago truncatula] gi|197294129|ref|YP_002149750.1| photosystem II cytochrome b559 alpha subunit [Cicer arietinum] gi|219673959|ref|YP_002456444.1| photosystem II cytochrome b559 alpha subunit [Trifolium subterraneum] gi|502181869|ref|XP_004516899.1| PREDICTED: cytochrome b559 subunit alpha-like [Cicer arietinum] gi|193788928|gb|ACF20524.1| photosystem II cytochrome b559 alpha subunit [Trifolium subterraneum] gi|197089817|gb|ACH41087.1| photosystem II cytochrome b559 alpha subunit [Cicer arietinum] gi|388495652|gb|AFK35892.1| unknown [Medicago truncatula] gi|388511557|gb|AFK43840.1| unknown [Lotus japonicus] gi|404332325|gb|AFR59957.1| photosystem II protein V [Medicago truncatula] gi|404332402|gb|AFR60033.1| photosystem II protein V [Medicago truncatula] gi|404332479|gb|AFR60109.1| photosystem II protein V [Medicago truncatula] gi|514994656|gb|AGO63635.1| photosystem II cytochrome b559 alpha subunit [Trifolium repens] gi|514994720|gb|AGO63698.1| photosystem II cytochrome b559 alpha subunit [Trifolium grandiflorum] gi|514994797|gb|AGO63774.1| photosystem II cytochrome b559 alpha subunit [Trifolium aureum] gi|528749847|gb|AGS43990.1| photosystem II cytochrome b559 alpha subunit [Vicia faba] gi|532693481|gb|AGU00086.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Glycyrrhiza glabra] gi|543174071|gb|AGV52587.1| photosystem II protein V (chloroplast) [Medicago truncatula f. tricycla] gi|545690154|gb|AGW45919.1| photosystem II cytochrome b559 alpha subunit [Lens culinaris] Length = 83 Score = 75.1 bits (183), Expect = 7e-11 Identities = 35/43 (81%), Positives = 38/43 (88%), Gaps = 2/43 (4%) Frame = +1 Query: 160 SIRYWIIHSITIPTLFIAGWLLVST--CYNMFGSPRPNEYFIE 282 SIRYWIIHSITIP+LFIAGWL VST Y++FGSPRPNEYF E Sbjct: 16 SIRYWIIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTE 58 >ref|YP_001122824.1| photosystem II cytochrome b559 alpha subunit [Phaseolus vulgaris] gi|289066844|ref|YP_003434362.1| photosystem II cytochrome b559 alpha subunit [Vigna radiata] gi|393396121|ref|YP_006460360.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Vigna unguiculata] gi|501594950|ref|YP_007889742.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Vigna angularis] gi|112030992|gb|ABH88104.1| photosystem II cytochrome b559 alpha subunit [Phaseolus vulgaris] gi|158187132|gb|ABW22765.1| photosystem II cytochrome b559 alpha subunit [Phaseolus vulgaris] gi|259020031|gb|ACV90229.1| photosystem II cytochrome b559 alpha subunit [Vigna radiata] gi|349589869|gb|AEP94840.1| photosystem II cytochrome b559 alpha subunit [Vigna unguiculata] gi|387598485|gb|AFJ91877.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Vigna unguiculata] gi|478620899|dbj|BAN14946.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Vigna angularis] Length = 83 Score = 75.1 bits (183), Expect = 7e-11 Identities = 35/43 (81%), Positives = 38/43 (88%), Gaps = 2/43 (4%) Frame = +1 Query: 160 SIRYWIIHSITIPTLFIAGWLLVST--CYNMFGSPRPNEYFIE 282 SIRYWIIHSITIP+LFIAGWL VST Y++FGSPRPNEYF E Sbjct: 16 SIRYWIIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTE 58 >gb|AAN32324.1| cytochrome b-559 alpha subunit, partial (chloroplast) [Dasypogon hookeri] Length = 75 Score = 75.1 bits (183), Expect = 7e-11 Identities = 35/43 (81%), Positives = 38/43 (88%), Gaps = 2/43 (4%) Frame = +1 Query: 160 SIRYWIIHSITIPTLFIAGWLLVST--CYNMFGSPRPNEYFIE 282 SIRYWIIHSITIP+LFIAGWL VST Y++FGSPRPNEYF E Sbjct: 8 SIRYWIIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTE 50 >gb|AAN32428.1| cytochrome b-559 alpha subunit, partial (chloroplast) [Xeronema callistemon] Length = 75 Score = 75.1 bits (183), Expect = 7e-11 Identities = 35/43 (81%), Positives = 38/43 (88%), Gaps = 2/43 (4%) Frame = +1 Query: 160 SIRYWIIHSITIPTLFIAGWLLVST--CYNMFGSPRPNEYFIE 282 SIRYWIIHSITIP+LFIAGWL VST Y++FGSPRPNEYF E Sbjct: 8 SIRYWIIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTE 50 >gb|AAQ05220.1| cytochrome b-559 alpha subunit [Bowenia serrulata] gi|33318698|gb|AAQ05240.1| cytochrome b-559 alpha subunit [Encephalartos barteri] gi|56682994|gb|AAW21830.1| cytochrome b-559 alpha subunit, partial (chloroplast) [Macrozamia moorei] Length = 75 Score = 75.1 bits (183), Expect = 7e-11 Identities = 35/43 (81%), Positives = 38/43 (88%), Gaps = 2/43 (4%) Frame = +1 Query: 160 SIRYWIIHSITIPTLFIAGWLLVST--CYNMFGSPRPNEYFIE 282 SIRYWIIHSITIP+LFIAGWL VST Y++FGSPRPNEYF E Sbjct: 8 SIRYWIIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTE 50 >gb|AAQ05236.1| cytochrome b-559 alpha subunit, partial (chloroplast) [Dioon purpusii] gi|56682989|gb|AAW21826.1| cytochrome b-559 alpha subunit, partial (chloroplast) [Lepidozamia hopei] Length = 75 Score = 75.1 bits (183), Expect = 7e-11 Identities = 35/43 (81%), Positives = 38/43 (88%), Gaps = 2/43 (4%) Frame = +1 Query: 160 SIRYWIIHSITIPTLFIAGWLLVST--CYNMFGSPRPNEYFIE 282 SIRYWIIHSITIP+LFIAGWL VST Y++FGSPRPNEYF E Sbjct: 8 SIRYWIIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTE 50 >gb|AAM55641.1| PsbE [Merremia hastata] Length = 83 Score = 75.1 bits (183), Expect = 7e-11 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 2/50 (4%) Frame = +1 Query: 139 TISSDANSIRYWIIHSITIPTLFIAGWLLVST--CYNMFGSPRPNEYFIE 282 + + SIRYW+IHSITIP+LFIAGWL VST Y++FGSPRPNEYF E Sbjct: 9 SFADSITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTE 58 >ref|YP_006665797.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Elodea canadensis] gi|456061468|ref|YP_007475636.1| photosystem II cytochrome b559 alpha subunit [Heliconia collinsiana] gi|511943388|ref|YP_008081667.1| cytochrome b559 alpha chain (chloroplast) [Cymbidium sinense] gi|511943501|ref|YP_008081823.1| cytochrome b559 alpha chain (chloroplast) [Cymbidium tracyanum] gi|512721449|ref|YP_008081745.1| cytochrome b559 alpha chain (chloroplast) [Cymbidium tortisepalum] gi|556927249|ref|YP_008758205.1| cytochrome b559 alpha chain (chloroplast) [Veratrum patulum] gi|563940569|ref|YP_008854442.1| photosystem II cytochrome b559 alpha subunit [Musa textilis] gi|563940671|ref|YP_008854527.1| photosystem II cytochrome b559 alpha subunit [Ravenala madagascariensis] gi|618750318|ref|YP_009026454.1| photosystem II protein V (chloroplast) [Dendrobium officinale] gi|548610|sp|P36442.2|PSBE_MESCR RecName: Full=Cytochrome b559 subunit alpha; AltName: Full=PSII reaction center subunit V gi|437300|gb|AAA21857.1| cytochrome b-559 alpha subunit [Mesembryanthemum crystallinum] gi|156598315|gb|ABU85418.1| photosystem II cytochrome b559 alpha subunit [Musa acuminata] gi|374094613|gb|AEY84669.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Elodea canadensis] gi|374974833|gb|AFA27508.1| photosystem II cytochrome b559 alpha subunit, partial [Flagellaria indica] gi|374974849|gb|AFA27516.1| photosystem II cytochrome b559 alpha subunit, partial [Kingia australis] gi|374974887|gb|AFA27535.1| photosystem II cytochrome b559 alpha subunit, partial [Thurnia sphaerocephala] gi|392841355|gb|AFM83310.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Kingia australis] gi|408903948|gb|AFU96558.1| PsbE, partial (chloroplast) [Chrysobalanus icaco] gi|408903958|gb|AFU96563.1| PsbE, partial (chloroplast) [Euphorbia maculata] gi|408903978|gb|AFU96573.1| PsbE, partial (chloroplast) [Linum usitatissimum] gi|449326115|gb|AGE92701.1| photosystem II cytochrome b559 alpha subunit [Heliconia collinsiana] gi|449326896|gb|AGE93473.1| photosystem II cytochrome b559 alpha subunit [Xiphidium caeruleum] gi|482662138|gb|AGK25366.1| cytochrome b559 alpha chain (chloroplast) [Cymbidium sinense] gi|482662217|gb|AGK25444.1| cytochrome b559 alpha chain (chloroplast) [Cymbidium tortisepalum] gi|482662296|gb|AGK25522.1| cytochrome b559 alpha chain (chloroplast) [Cymbidium tortisepalum] gi|482662454|gb|AGK25678.1| cytochrome b559 alpha chain (chloroplast) [Cymbidium tracyanum] gi|482662533|gb|AGK25756.1| cytochrome b559 alpha chain (chloroplast) [Cymbidium tortisepalum] gi|507474336|gb|AGM48212.1| photosystem II protein V (chloroplast) [Dendrobium officinale] gi|525312474|emb|CCW72392.1| psbF (chloroplast) [Musa acuminata subsp. malaccensis] gi|549531734|gb|AGX28860.1| cytochrome b559 alpha chain (chloroplast) [Veratrum patulum] gi|557636929|gb|AHA12531.1| photosystem II cytochrome b559 alpha subunit [Musa textilis] gi|557637015|gb|AHA12616.1| photosystem II cytochrome b559 alpha subunit [Ravenala madagascariensis] gi|557637173|gb|AHA12772.1| photosystem II cytochrome b559 alpha subunit [Canna indica] gi|557637257|gb|AHA12855.1| photosystem II cytochrome b559 alpha subunit [Maranta leuconeura] gi|557637344|gb|AHA12941.1| photosystem II cytochrome b559 alpha subunit [Monocostus uniflorus] gi|557637431|gb|AHA13027.1| photosystem II cytochrome b559 alpha subunit [Costus pulverulentus] gi|557637605|gb|AHA13199.1| photosystem II cytochrome b559 alpha subunit [Thaumatococcus daniellii] Length = 83 Score = 74.7 bits (182), Expect = 1e-10 Identities = 34/43 (79%), Positives = 38/43 (88%), Gaps = 2/43 (4%) Frame = +1 Query: 160 SIRYWIIHSITIPTLFIAGWLLVST--CYNMFGSPRPNEYFIE 282 SIRYW+IHSITIP+LFIAGWL VST Y++FGSPRPNEYF E Sbjct: 16 SIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTE 58