BLASTX nr result
ID: Paeonia24_contig00016272
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00016272 (339 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006448305.1| hypothetical protein CICLE_v10017676mg [Citr... 55 8e-06 >ref|XP_006448305.1| hypothetical protein CICLE_v10017676mg [Citrus clementina] gi|557550916|gb|ESR61545.1| hypothetical protein CICLE_v10017676mg [Citrus clementina] Length = 345 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/42 (54%), Positives = 32/42 (76%) Frame = -1 Query: 339 MLNGVAVTFPNIYYSDWLVVHGLGEILVVPEMQEEVAKVSTE 214 MLNGV ++ PN+YYSDWLVVHG+ +L VP +E A+ S++ Sbjct: 292 MLNGVVISSPNLYYSDWLVVHGIHGVLAVPATPKEAAESSSQ 333