BLASTX nr result
ID: Paeonia24_contig00016148
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00016148 (213 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004503901.1| PREDICTED: NAC domain-containing protein 2-l... 82 8e-14 gb|ABM88941.1| NAC transcription factor [Cucumis melo] 82 8e-14 ref|XP_004147329.1| PREDICTED: NAC domain-containing protein 2-l... 81 1e-13 ref|XP_002285870.2| PREDICTED: NAC domain-containing protein 2-l... 81 1e-13 emb|CBI18995.3| unnamed protein product [Vitis vinifera] 81 1e-13 ref|XP_004502989.1| PREDICTED: NAC domain-containing protein 2-l... 81 2e-13 gb|ACG49995.1| NAC-like transcription factor [Arachis hypogaea] 81 2e-13 gb|AFK44664.1| unknown [Medicago truncatula] 80 2e-13 gb|AGO14648.1| NAC transcription factor [Glycine max] 80 2e-13 ref|XP_003602684.1| NAC-domain protein [Medicago truncatula] gi|... 80 2e-13 ref|NP_001242877.1| uncharacterized protein LOC100779770 [Glycin... 80 2e-13 ref|XP_003602683.1| NAC-domain protein [Medicago truncatula] gi|... 80 2e-13 ref|XP_006305484.1| hypothetical protein CARUB_v10009926mg [Caps... 80 3e-13 ref|NP_171677.1| putative transcriptional activator with NAC dom... 80 3e-13 ref|XP_003525136.1| PREDICTED: NAC domain-containing protein 2 [... 80 3e-13 ref|XP_003523205.1| PREDICTED: NAC domain-containing protein 2 [... 80 3e-13 gb|AEF80001.1| nam-like protein [Corylus heterophylla] 80 3e-13 ref|XP_002892047.1| hypothetical protein ARALYDRAFT_887272 [Arab... 80 3e-13 gb|ACI15342.1| NAC domain protein NAC2 [Gossypium hirsutum] gi|2... 80 3e-13 gb|ACD39384.1| NAC domain protein, partial [Glycine max] 80 3e-13 >ref|XP_004503901.1| PREDICTED: NAC domain-containing protein 2-like [Cicer arietinum] Length = 289 Score = 82.0 bits (201), Expect = 8e-14 Identities = 37/44 (84%), Positives = 39/44 (88%) Frame = +3 Query: 81 MNGGLSLPPGFRFHPTDEELVIHYLCRKCASQSIAVPIIKDIDL 212 M G L LPPGFRFHPTDEELV HYLCRKC+SQ IAVPIIK+IDL Sbjct: 1 MQGALDLPPGFRFHPTDEELVNHYLCRKCSSQPIAVPIIKEIDL 44 >gb|ABM88941.1| NAC transcription factor [Cucumis melo] Length = 298 Score = 82.0 bits (201), Expect = 8e-14 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = +3 Query: 90 GLSLPPGFRFHPTDEELVIHYLCRKCASQSIAVPIIKDIDL 212 GL LPPGFRFHPTDEELV+HYLCRKC+SQ IAVPIIK+IDL Sbjct: 5 GLELPPGFRFHPTDEELVLHYLCRKCSSQPIAVPIIKEIDL 45 >ref|XP_004147329.1| PREDICTED: NAC domain-containing protein 2-like [Cucumis sativus] gi|449508701|ref|XP_004163386.1| PREDICTED: NAC domain-containing protein 2-like [Cucumis sativus] Length = 299 Score = 81.3 bits (199), Expect = 1e-13 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = +3 Query: 90 GLSLPPGFRFHPTDEELVIHYLCRKCASQSIAVPIIKDIDL 212 GL LPPGFRFHPTDEELV+HYLCRKC+SQ IAVPIIK+IDL Sbjct: 5 GLVLPPGFRFHPTDEELVLHYLCRKCSSQPIAVPIIKEIDL 45 >ref|XP_002285870.2| PREDICTED: NAC domain-containing protein 2-like [Vitis vinifera] Length = 380 Score = 81.3 bits (199), Expect = 1e-13 Identities = 37/44 (84%), Positives = 39/44 (88%) Frame = +3 Query: 81 MNGGLSLPPGFRFHPTDEELVIHYLCRKCASQSIAVPIIKDIDL 212 M L LPPGFRFHPTDEELV+HYLCRKCASQSIAVPII +IDL Sbjct: 82 MTAELQLPPGFRFHPTDEELVMHYLCRKCASQSIAVPIIAEIDL 125 >emb|CBI18995.3| unnamed protein product [Vitis vinifera] Length = 263 Score = 81.3 bits (199), Expect = 1e-13 Identities = 37/44 (84%), Positives = 39/44 (88%) Frame = +3 Query: 81 MNGGLSLPPGFRFHPTDEELVIHYLCRKCASQSIAVPIIKDIDL 212 M L LPPGFRFHPTDEELV+HYLCRKCASQSIAVPII +IDL Sbjct: 1 MTAELQLPPGFRFHPTDEELVMHYLCRKCASQSIAVPIIAEIDL 44 >ref|XP_004502989.1| PREDICTED: NAC domain-containing protein 2-like [Cicer arietinum] Length = 289 Score = 80.9 bits (198), Expect = 2e-13 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = +3 Query: 81 MNGGLSLPPGFRFHPTDEELVIHYLCRKCASQSIAVPIIKDIDL 212 M G L LPPGFRFHPTDEELV HYLCRKCA QSI+VP++K+IDL Sbjct: 1 MKGELELPPGFRFHPTDEELVNHYLCRKCAGQSISVPVVKEIDL 44 >gb|ACG49995.1| NAC-like transcription factor [Arachis hypogaea] Length = 260 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/44 (84%), Positives = 39/44 (88%) Frame = +3 Query: 81 MNGGLSLPPGFRFHPTDEELVIHYLCRKCASQSIAVPIIKDIDL 212 M L LPPGFRFHPTDEELV HYLC+KCASQSIAVPIIK+IDL Sbjct: 1 MKSELELPPGFRFHPTDEELVNHYLCKKCASQSIAVPIIKEIDL 44 >gb|AFK44664.1| unknown [Medicago truncatula] Length = 152 Score = 80.5 bits (197), Expect = 2e-13 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = +3 Query: 81 MNGGLSLPPGFRFHPTDEELVIHYLCRKCASQSIAVPIIKDIDL 212 M G L LPPGFRFHPTDEELV HYLCRKCA QSI+VP++K++DL Sbjct: 1 MQGELELPPGFRFHPTDEELVNHYLCRKCAGQSISVPVVKEVDL 44 >gb|AGO14648.1| NAC transcription factor [Glycine max] Length = 295 Score = 80.5 bits (197), Expect = 2e-13 Identities = 36/44 (81%), Positives = 38/44 (86%) Frame = +3 Query: 81 MNGGLSLPPGFRFHPTDEELVIHYLCRKCASQSIAVPIIKDIDL 212 M G L LPPGFRFHPTDEELV HYLCRKCA Q IAVPIIK++DL Sbjct: 1 MKGELELPPGFRFHPTDEELVNHYLCRKCAGQPIAVPIIKEVDL 44 >ref|XP_003602684.1| NAC-domain protein [Medicago truncatula] gi|355491732|gb|AES72935.1| NAC-domain protein [Medicago truncatula] Length = 329 Score = 80.5 bits (197), Expect = 2e-13 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = +3 Query: 81 MNGGLSLPPGFRFHPTDEELVIHYLCRKCASQSIAVPIIKDIDL 212 M G L LPPGFRFHPTDEELV HYLCRKCA QSI+VP++K++DL Sbjct: 1 MQGELELPPGFRFHPTDEELVNHYLCRKCAGQSISVPVVKEVDL 44 >ref|NP_001242877.1| uncharacterized protein LOC100779770 [Glycine max] gi|255640977|gb|ACU20768.1| unknown [Glycine max] Length = 295 Score = 80.5 bits (197), Expect = 2e-13 Identities = 36/44 (81%), Positives = 38/44 (86%) Frame = +3 Query: 81 MNGGLSLPPGFRFHPTDEELVIHYLCRKCASQSIAVPIIKDIDL 212 M G L LPPGFRFHPTDEELV HYLCRKCA Q IAVPIIK++DL Sbjct: 1 MKGELELPPGFRFHPTDEELVNHYLCRKCAGQPIAVPIIKEVDL 44 >ref|XP_003602683.1| NAC-domain protein [Medicago truncatula] gi|217073174|gb|ACJ84946.1| unknown [Medicago truncatula] gi|355491731|gb|AES72934.1| NAC-domain protein [Medicago truncatula] gi|388500512|gb|AFK38322.1| unknown [Medicago truncatula] Length = 292 Score = 80.5 bits (197), Expect = 2e-13 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = +3 Query: 81 MNGGLSLPPGFRFHPTDEELVIHYLCRKCASQSIAVPIIKDIDL 212 M G L LPPGFRFHPTDEELV HYLCRKCA QSI+VP++K++DL Sbjct: 1 MQGELELPPGFRFHPTDEELVNHYLCRKCAGQSISVPVVKEVDL 44 >ref|XP_006305484.1| hypothetical protein CARUB_v10009926mg [Capsella rubella] gi|482574195|gb|EOA38382.1| hypothetical protein CARUB_v10009926mg [Capsella rubella] Length = 286 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +3 Query: 93 LSLPPGFRFHPTDEELVIHYLCRKCASQSIAVPIIKDIDL 212 L LPPGFRFHPTDEELV+HYLCRKCASQSIAVPII +IDL Sbjct: 4 LQLPPGFRFHPTDEELVMHYLCRKCASQSIAVPIIAEIDL 43 >ref|NP_171677.1| putative transcriptional activator with NAC domain [Arabidopsis thaliana] gi|51316206|sp|Q39013.2|NAC2_ARATH RecName: Full=NAC domain-containing protein 2; Short=ANAC002 gi|8671840|gb|AAF78403.1|AC009273_9 Strong similarity to OsNAC6 protein from Oryza sativa gb|AB028185. ESTs gb|AI996805, gb|T22869 and gb|AI100172 come from this gene [Arabidopsis thaliana] gi|13877717|gb|AAK43936.1|AF370617_1 OsNAC6 protein-like protein [Arabidopsis thaliana] gi|87116660|gb|ABD19694.1| At1g01720 [Arabidopsis thaliana] gi|332189205|gb|AEE27326.1| NAC domain-containing protein [Arabidopsis thaliana] Length = 289 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +3 Query: 93 LSLPPGFRFHPTDEELVIHYLCRKCASQSIAVPIIKDIDL 212 L LPPGFRFHPTDEELV+HYLCRKCASQSIAVPII +IDL Sbjct: 5 LQLPPGFRFHPTDEELVMHYLCRKCASQSIAVPIIAEIDL 44 >ref|XP_003525136.1| PREDICTED: NAC domain-containing protein 2 [Glycine max] Length = 298 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = +3 Query: 81 MNGGLSLPPGFRFHPTDEELVIHYLCRKCASQSIAVPIIKDIDL 212 M G L LPPGFRFHPTD+ELV HYLCRKCA+Q+IAVPIIK+IDL Sbjct: 1 MPGELQLPPGFRFHPTDDELVNHYLCRKCAAQTIAVPIIKEIDL 44 >ref|XP_003523205.1| PREDICTED: NAC domain-containing protein 2 [Glycine max] Length = 291 Score = 80.1 bits (196), Expect = 3e-13 Identities = 35/44 (79%), Positives = 38/44 (86%) Frame = +3 Query: 81 MNGGLSLPPGFRFHPTDEELVIHYLCRKCASQSIAVPIIKDIDL 212 M G L LPPGFRFHPTDEELV HYLCRKCA Q IAVP+IK++DL Sbjct: 1 MKGELELPPGFRFHPTDEELVNHYLCRKCAGQPIAVPVIKEVDL 44 >gb|AEF80001.1| nam-like protein [Corylus heterophylla] Length = 291 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/44 (81%), Positives = 39/44 (88%) Frame = +3 Query: 81 MNGGLSLPPGFRFHPTDEELVIHYLCRKCASQSIAVPIIKDIDL 212 M L LPPGFRFHPTD+ELV+HYLCRKCASQSIAVPII +IDL Sbjct: 1 MTAELQLPPGFRFHPTDDELVMHYLCRKCASQSIAVPIIAEIDL 44 >ref|XP_002892047.1| hypothetical protein ARALYDRAFT_887272 [Arabidopsis lyrata subsp. lyrata] gi|297337889|gb|EFH68306.1| hypothetical protein ARALYDRAFT_887272 [Arabidopsis lyrata subsp. lyrata] Length = 295 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +3 Query: 93 LSLPPGFRFHPTDEELVIHYLCRKCASQSIAVPIIKDIDL 212 L LPPGFRFHPTDEELV+HYLCRKCASQSIAVPII +IDL Sbjct: 5 LQLPPGFRFHPTDEELVMHYLCRKCASQSIAVPIIAEIDL 44 >gb|ACI15342.1| NAC domain protein NAC2 [Gossypium hirsutum] gi|206584351|gb|ACI15348.1| NAC domain protein NAC2 [Gossypium hirsutum] Length = 299 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +3 Query: 93 LSLPPGFRFHPTDEELVIHYLCRKCASQSIAVPIIKDIDL 212 L LPPGFRFHPTDEELV+HYLCRKCASQSIAVPII +IDL Sbjct: 6 LQLPPGFRFHPTDEELVMHYLCRKCASQSIAVPIIAEIDL 45 >gb|ACD39384.1| NAC domain protein, partial [Glycine max] Length = 298 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = +3 Query: 81 MNGGLSLPPGFRFHPTDEELVIHYLCRKCASQSIAVPIIKDIDL 212 M G L LPPGFRFHPTD+ELV HYLCRKCA+Q+IAVPIIK+IDL Sbjct: 1 MPGELQLPPGFRFHPTDDELVNHYLCRKCAAQTIAVPIIKEIDL 44