BLASTX nr result
ID: Paeonia24_contig00014787
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00014787 (368 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006489244.1| PREDICTED: BTB/POZ and MATH domain-containin... 65 1e-08 ref|XP_006419782.1| hypothetical protein CICLE_v10005094mg [Citr... 65 1e-08 ref|XP_007034571.1| BTB-POZ and MATH domain 2 [Theobroma cacao] ... 59 7e-07 ref|XP_006444138.1| hypothetical protein CICLE_v10020406mg [Citr... 58 2e-06 emb|CBI32329.3| unnamed protein product [Vitis vinifera] 57 3e-06 gb|EXB95854.1| BTB/POZ and MATH domain-containing protein 2 [Mor... 56 5e-06 ref|XP_003631982.1| PREDICTED: BTB/POZ and MATH domain-containin... 56 5e-06 ref|XP_002279548.1| PREDICTED: BTB/POZ and MATH domain-containin... 56 5e-06 >ref|XP_006489244.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Citrus sinensis] Length = 403 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +2 Query: 2 LLQYVAKISEHSVIACGYGIETSPDGGDVNGRRVKQRIY 118 LLQYVAKI EHSVIA G+G ET PDG DVNGRRVKQR++ Sbjct: 365 LLQYVAKIGEHSVIASGHGNETLPDGCDVNGRRVKQRVH 403 >ref|XP_006419782.1| hypothetical protein CICLE_v10005094mg [Citrus clementina] gi|557521655|gb|ESR33022.1| hypothetical protein CICLE_v10005094mg [Citrus clementina] Length = 403 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +2 Query: 2 LLQYVAKISEHSVIACGYGIETSPDGGDVNGRRVKQRIY 118 LLQYVAKI EHSVIA G+G ET PDG DVNGRRVKQR++ Sbjct: 365 LLQYVAKIGEHSVIASGHGNETLPDGCDVNGRRVKQRVH 403 >ref|XP_007034571.1| BTB-POZ and MATH domain 2 [Theobroma cacao] gi|508713600|gb|EOY05497.1| BTB-POZ and MATH domain 2 [Theobroma cacao] Length = 410 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = +2 Query: 2 LLQYVAKISEHSVIACGYGIETSPDGGDVNGRRVKQRI 115 LL YVA+I EHSVIACGY ETS DG DVNGRRVK R+ Sbjct: 372 LLHYVARIGEHSVIACGYRKETSFDGCDVNGRRVKPRL 409 >ref|XP_006444138.1| hypothetical protein CICLE_v10020406mg [Citrus clementina] gi|568852211|ref|XP_006479773.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Citrus sinensis] gi|557546400|gb|ESR57378.1| hypothetical protein CICLE_v10020406mg [Citrus clementina] Length = 407 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = +2 Query: 2 LLQYVAKISEHSVIACGYGIETSPDGGDVNGRRVKQRI 115 LL+YVAK+SEHSV+ C +G E DG DVNGRRVKQR+ Sbjct: 370 LLEYVAKVSEHSVVVCRHGNEAILDGSDVNGRRVKQRL 407 >emb|CBI32329.3| unnamed protein product [Vitis vinifera] Length = 402 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = +2 Query: 2 LLQYVAKISEHSVIACGYGIETSPDGGDVNGRRVKQRI 115 LL+YVA++SEHSVI C +G E DG D+NGRRVKQR+ Sbjct: 365 LLEYVARVSEHSVIVCRHGNEAILDGSDINGRRVKQRL 402 >gb|EXB95854.1| BTB/POZ and MATH domain-containing protein 2 [Morus notabilis] Length = 412 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/39 (71%), Positives = 30/39 (76%) Frame = +2 Query: 2 LLQYVAKISEHSVIACGYGIETSPDGGDVNGRRVKQRIY 118 LLQYVA+I EHSVIA GYG T DG DVN RRVK R+Y Sbjct: 374 LLQYVARIGEHSVIASGYGKVTLLDGSDVNRRRVKPRLY 412 >ref|XP_003631982.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2 isoform 2 [Vitis vinifera] Length = 443 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/40 (70%), Positives = 32/40 (80%), Gaps = 1/40 (2%) Frame = +2 Query: 2 LLQYVAKISEHSVIACGYGIET-SPDGGDVNGRRVKQRIY 118 LL+YVA+I EHSVI CG+G E DG DVNGRRVKQRI+ Sbjct: 404 LLEYVARIGEHSVIVCGHGNENILLDGSDVNGRRVKQRIF 443 >ref|XP_002279548.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2 isoform 1 [Vitis vinifera] gi|297736968|emb|CBI26169.3| unnamed protein product [Vitis vinifera] Length = 408 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/40 (70%), Positives = 32/40 (80%), Gaps = 1/40 (2%) Frame = +2 Query: 2 LLQYVAKISEHSVIACGYGIET-SPDGGDVNGRRVKQRIY 118 LL+YVA+I EHSVI CG+G E DG DVNGRRVKQRI+ Sbjct: 369 LLEYVARIGEHSVIVCGHGNENILLDGSDVNGRRVKQRIF 408