BLASTX nr result
ID: Paeonia24_contig00014613
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00014613 (361 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007035349.1| F-box family protein, putative [Theobroma ca... 60 3e-07 gb|EYU31751.1| hypothetical protein MIMGU_mgv1a020117mg [Mimulus... 58 1e-06 ref|XP_006380187.1| hypothetical protein POPTR_0008s22720g [Popu... 57 3e-06 ref|XP_006380186.1| hypothetical protein POPTR_0008s22710g, part... 57 3e-06 ref|XP_006380075.1| hypothetical protein POPTR_0008s212101g, par... 57 3e-06 ref|XP_007147813.1| hypothetical protein PHAVU_006G157000g [Phas... 57 3e-06 ref|XP_002312504.2| hypothetical protein POPTR_0008s14300g [Popu... 57 3e-06 ref|NP_001241466.1| uncharacterized protein LOC100815072 [Glycin... 56 5e-06 gb|EYU25734.1| hypothetical protein MIMGU_mgv1a027018mg, partial... 56 6e-06 ref|XP_006380073.1| hypothetical protein POPTR_0008s21190g [Popu... 56 6e-06 ref|XP_007099666.1| F-box family protein, putative [Theobroma ca... 56 6e-06 ref|XP_007034259.1| Phenylalanyl-tRNA synthetase class IIc famil... 56 6e-06 >ref|XP_007035349.1| F-box family protein, putative [Theobroma cacao] gi|508714378|gb|EOY06275.1| F-box family protein, putative [Theobroma cacao] Length = 474 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/48 (54%), Positives = 35/48 (72%) Frame = +1 Query: 214 EEMEVPELPSNIILDVLSRLPVKTLSKFKCVSKLWCQYISDVYFYRLH 357 EE E+P LP II+++LSRLP+K+L +F+CVSKLW ISD + H Sbjct: 74 EEAEIPILPQEIIVEILSRLPIKSLCQFRCVSKLWLSLISDPLLAKAH 121 >gb|EYU31751.1| hypothetical protein MIMGU_mgv1a020117mg [Mimulus guttatus] Length = 387 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/57 (47%), Positives = 35/57 (61%) Frame = +1 Query: 187 GIKRCRLSGEEMEVPELPSNIILDVLSRLPVKTLSKFKCVSKLWCQYISDVYFYRLH 357 G + ++ GE EV E P II ++L RLPVK L +F+CVSK W IS F +LH Sbjct: 2 GQSQSKMEGESSEVHEFPEEIIEEILKRLPVKPLVRFRCVSKSWLSIISSPVFIKLH 58 >ref|XP_006380187.1| hypothetical protein POPTR_0008s22720g [Populus trichocarpa] gi|550333708|gb|ERP57984.1| hypothetical protein POPTR_0008s22720g [Populus trichocarpa] Length = 451 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/51 (47%), Positives = 36/51 (70%) Frame = +1 Query: 205 LSGEEMEVPELPSNIILDVLSRLPVKTLSKFKCVSKLWCQYISDVYFYRLH 357 ++ E + +LPS +I+D+LSRLP+KT+ +CV K W YISD +F +LH Sbjct: 17 IASSECLMNKLPSCLIMDILSRLPIKTILNCRCVCKTWLHYISDSFFAKLH 67 >ref|XP_006380186.1| hypothetical protein POPTR_0008s22710g, partial [Populus trichocarpa] gi|550333707|gb|ERP57983.1| hypothetical protein POPTR_0008s22710g, partial [Populus trichocarpa] Length = 319 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/51 (47%), Positives = 36/51 (70%) Frame = +1 Query: 205 LSGEEMEVPELPSNIILDVLSRLPVKTLSKFKCVSKLWCQYISDVYFYRLH 357 ++ E + +LPS +I+D+LSRLP+KT+ +CV K W YISD +F +LH Sbjct: 18 IASSECLMNKLPSCLIMDILSRLPIKTILNCRCVCKTWLHYISDSFFAKLH 68 >ref|XP_006380075.1| hypothetical protein POPTR_0008s212101g, partial [Populus trichocarpa] gi|550333594|gb|ERP57872.1| hypothetical protein POPTR_0008s212101g, partial [Populus trichocarpa] Length = 215 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/51 (47%), Positives = 36/51 (70%) Frame = +1 Query: 205 LSGEEMEVPELPSNIILDVLSRLPVKTLSKFKCVSKLWCQYISDVYFYRLH 357 ++ E + +LPS +I+D+LSRLP+KT+ +CV K W YISD +F +LH Sbjct: 18 IASSECLMNKLPSCLIMDILSRLPIKTILNCRCVCKTWLHYISDSFFAKLH 68 >ref|XP_007147813.1| hypothetical protein PHAVU_006G157000g [Phaseolus vulgaris] gi|561021036|gb|ESW19807.1| hypothetical protein PHAVU_006G157000g [Phaseolus vulgaris] Length = 410 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/48 (47%), Positives = 35/48 (72%) Frame = +1 Query: 214 EEMEVPELPSNIILDVLSRLPVKTLSKFKCVSKLWCQYISDVYFYRLH 357 E + +P LP+ +++++LSRLPVK+L +F+CV K W ISD YF + H Sbjct: 47 ESLPLPFLPNELVVEILSRLPVKSLLQFRCVCKSWMSLISDPYFMKKH 94 >ref|XP_002312504.2| hypothetical protein POPTR_0008s14300g [Populus trichocarpa] gi|550333060|gb|EEE89871.2| hypothetical protein POPTR_0008s14300g [Populus trichocarpa] Length = 433 Score = 56.6 bits (135), Expect = 3e-06 Identities = 20/42 (47%), Positives = 32/42 (76%) Frame = +1 Query: 235 LPSNIILDVLSRLPVKTLSKFKCVSKLWCQYISDVYFYRLHH 360 +P ++ILD+L+RLP K++ +F+CVS+ WC + D +F LHH Sbjct: 26 IPDDVILDILTRLPAKSVVRFRCVSRTWCSFTHDPFFASLHH 67 >ref|NP_001241466.1| uncharacterized protein LOC100815072 [Glycine max] gi|255637050|gb|ACU18857.1| unknown [Glycine max] Length = 406 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/48 (47%), Positives = 34/48 (70%) Frame = +1 Query: 214 EEMEVPELPSNIILDVLSRLPVKTLSKFKCVSKLWCQYISDVYFYRLH 357 E + +P LP +++++LSRLPVK+L +F+CV K W ISD YF + H Sbjct: 42 ESLPLPFLPDELVVEILSRLPVKSLLQFRCVCKSWMSLISDPYFMKKH 89 >gb|EYU25734.1| hypothetical protein MIMGU_mgv1a027018mg, partial [Mimulus guttatus] Length = 418 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/48 (54%), Positives = 33/48 (68%) Frame = +1 Query: 214 EEMEVPELPSNIILDVLSRLPVKTLSKFKCVSKLWCQYISDVYFYRLH 357 E P LP ++I+D+L RLPVK+L KFKCVSK W + I+D F LH Sbjct: 53 ERTAEPTLPDDLIVDILLRLPVKSLGKFKCVSKQWRRLITDPRFNSLH 100 >ref|XP_006380073.1| hypothetical protein POPTR_0008s21190g [Populus trichocarpa] gi|550333592|gb|ERP57870.1| hypothetical protein POPTR_0008s21190g [Populus trichocarpa] Length = 446 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/42 (54%), Positives = 32/42 (76%) Frame = +1 Query: 232 ELPSNIILDVLSRLPVKTLSKFKCVSKLWCQYISDVYFYRLH 357 +LPS +I+D+LSRLP+KT+ +CV K W YISD +F +LH Sbjct: 3 KLPSCLIMDILSRLPIKTILNCRCVCKTWLHYISDSFFAKLH 44 >ref|XP_007099666.1| F-box family protein, putative [Theobroma cacao] gi|508728466|gb|EOY20363.1| F-box family protein, putative [Theobroma cacao] Length = 372 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/43 (58%), Positives = 35/43 (81%) Frame = +1 Query: 226 VPELPSNIILDVLSRLPVKTLSKFKCVSKLWCQYISDVYFYRL 354 +P+LP +II+++LSRLPVK+L +FKCVSK W ISD +F +L Sbjct: 4 LPQLPQDIIVNILSRLPVKSLLQFKCVSKPWRSLISDPHFAKL 46 >ref|XP_007034259.1| Phenylalanyl-tRNA synthetase class IIc family protein [Theobroma cacao] gi|508713288|gb|EOY05185.1| Phenylalanyl-tRNA synthetase class IIc family protein [Theobroma cacao] Length = 724 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/43 (58%), Positives = 35/43 (81%) Frame = +1 Query: 226 VPELPSNIILDVLSRLPVKTLSKFKCVSKLWCQYISDVYFYRL 354 +P+LP +II+++LSRLPVK+L +FKCVSK W ISD +F +L Sbjct: 4 LPQLPQDIIVNILSRLPVKSLLQFKCVSKPWRSLISDPHFAKL 46