BLASTX nr result
ID: Paeonia24_contig00012622
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00012622 (323 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAG60242.1| cytochrome oxidase subunit 1 [Pseudofumaria lutea] 107 2e-21 gb|AAG60244.1| cytochrome oxidase subunit 1 [Drimys winteri] 107 2e-21 gb|ABY66628.1| cytochrome oxidase subunit I [Lamprocapnos specta... 107 2e-21 gb|AAF77689.1|AF193963_1 chytochrome oxidase subunit 1 [Euptelea... 107 2e-21 gb|ABY66680.1| cytochrome oxidase subunit I [Gunnera sp. CWD 94.84] 106 3e-21 gb|AAF77683.1|AF193957_1 chytochrome oxidase subunit 1 [Polyalth... 106 3e-21 gb|AAG60230.1| cytochrome oxidase subunit 1 [Akebia quinata] 104 1e-20 gb|ACV81905.1| cytochrome oxidase subunit I [Scoliopus bigelovii] 104 1e-20 gb|ACV81904.1| cytochrome oxidase subunit I [Prosartes hookeri] 104 1e-20 gb|ACV81900.1| cytochrome oxidase subunit I [Clintonia borealis] 104 1e-20 gb|ACV81898.1| cytochrome oxidase subunit I [Calochortus macroca... 104 1e-20 gb|AAF77676.1|AF193950_1 chytochrome oxidase subunit 1 [Nelumbo ... 104 1e-20 gb|AAD01675.1| cytochrome c oxidase [Trochodendron aralioides] 104 1e-20 gb|AAG60252.1| cytochrome oxidase subunit 1 [Ranunculus carolini... 104 1e-20 ref|YP_007905714.1| cytochrome c oxidase subunit 1 (mitochondrio... 103 2e-20 gb|AAD01662.1| cytochrome c oxidase [Magnolia grandiflora] 103 2e-20 gb|AAG60245.1| cytochrome oxidase subunit 1 [Eupomatia laurina] 103 2e-20 gb|AAC98472.1| cytochrome oxidase subunit 1, partial (mitochondr... 103 2e-20 gb|ABI96916.1| cytochrome oxidase subunit 1 [Liriodendron tulipi... 103 2e-20 gb|AAF77690.1|AF193964_1 chytochrome oxidase subunit 1 [Tetracen... 103 2e-20 >gb|AAG60242.1| cytochrome oxidase subunit 1 [Pseudofumaria lutea] Length = 471 Score = 107 bits (266), Expect = 2e-21 Identities = 53/65 (81%), Positives = 58/65 (89%), Gaps = 1/65 (1%) Frame = +3 Query: 45 EHLFQFFGHPDVCIPILPGSGIISHIVLTFLGKPVFG-*GMVYAMISTGVLGSLVRAHHL 221 +HLF+FFGHP+V IPILPGSGIISHIV TF GKPVFG GMVYAMISTGVLGSLVRAHH+ Sbjct: 200 QHLFRFFGHPEVYIPILPGSGIISHIVSTFSGKPVFGYLGMVYAMISTGVLGSLVRAHHM 259 Query: 222 FPVAT 236 F V + Sbjct: 260 FTVGS 264 >gb|AAG60244.1| cytochrome oxidase subunit 1 [Drimys winteri] Length = 471 Score = 107 bits (266), Expect = 2e-21 Identities = 53/65 (81%), Positives = 58/65 (89%), Gaps = 1/65 (1%) Frame = +3 Query: 45 EHLFQFFGHPDVCIPILPGSGIISHIVLTFLGKPVFG-*GMVYAMISTGVLGSLVRAHHL 221 +HLF+FFGHP+V IPILPGSGIISHIV TF GKPVFG GMVYAMISTGVLGSLVRAHH+ Sbjct: 200 QHLFRFFGHPEVYIPILPGSGIISHIVSTFSGKPVFGYLGMVYAMISTGVLGSLVRAHHM 259 Query: 222 FPVAT 236 F V + Sbjct: 260 FTVGS 264 >gb|ABY66628.1| cytochrome oxidase subunit I [Lamprocapnos spectabilis] Length = 459 Score = 107 bits (266), Expect = 2e-21 Identities = 53/65 (81%), Positives = 58/65 (89%), Gaps = 1/65 (1%) Frame = +3 Query: 45 EHLFQFFGHPDVCIPILPGSGIISHIVLTFLGKPVFG-*GMVYAMISTGVLGSLVRAHHL 221 +HLF+FFGHP+V IPILPGSGIISHIV TF GKPVFG GMVYAMISTGVLGSLVRAHH+ Sbjct: 193 QHLFRFFGHPEVYIPILPGSGIISHIVSTFSGKPVFGYLGMVYAMISTGVLGSLVRAHHM 252 Query: 222 FPVAT 236 F V + Sbjct: 253 FTVGS 257 >gb|AAF77689.1|AF193963_1 chytochrome oxidase subunit 1 [Euptelea polyandra] Length = 471 Score = 107 bits (266), Expect = 2e-21 Identities = 53/65 (81%), Positives = 58/65 (89%), Gaps = 1/65 (1%) Frame = +3 Query: 45 EHLFQFFGHPDVCIPILPGSGIISHIVLTFLGKPVFG-*GMVYAMISTGVLGSLVRAHHL 221 +HLF+FFGHP+V IPILPGSGIISHIV TF GKPVFG GMVYAMISTGVLGSLVRAHH+ Sbjct: 200 QHLFRFFGHPEVYIPILPGSGIISHIVSTFSGKPVFGYLGMVYAMISTGVLGSLVRAHHM 259 Query: 222 FPVAT 236 F V + Sbjct: 260 FTVGS 264 >gb|ABY66680.1| cytochrome oxidase subunit I [Gunnera sp. CWD 94.84] Length = 472 Score = 106 bits (265), Expect = 3e-21 Identities = 53/63 (84%), Positives = 57/63 (90%), Gaps = 1/63 (1%) Frame = +3 Query: 45 EHLFQFFGHPDVCIPILPGSGIISHIVLTFLGKPVFG-*GMVYAMISTGVLGSLVRAHHL 221 +HLF+FFGHP+V IPILPGSGIISHIV TF GKPVFG GMVYAMISTGVLGSLVRAHH+ Sbjct: 200 QHLFRFFGHPEVYIPILPGSGIISHIVSTFSGKPVFGYLGMVYAMISTGVLGSLVRAHHM 259 Query: 222 FPV 230 F V Sbjct: 260 FTV 262 >gb|AAF77683.1|AF193957_1 chytochrome oxidase subunit 1 [Polyalthia suberosa] Length = 471 Score = 106 bits (265), Expect = 3e-21 Identities = 53/63 (84%), Positives = 57/63 (90%), Gaps = 1/63 (1%) Frame = +3 Query: 45 EHLFQFFGHPDVCIPILPGSGIISHIVLTFLGKPVFG-*GMVYAMISTGVLGSLVRAHHL 221 +HLF+FFGHP+V IPILPGSGIISHIV TF GKPVFG GMVYAMISTGVLGSLVRAHH+ Sbjct: 200 QHLFRFFGHPEVYIPILPGSGIISHIVSTFSGKPVFGYLGMVYAMISTGVLGSLVRAHHM 259 Query: 222 FPV 230 F V Sbjct: 260 FTV 262 >gb|AAG60230.1| cytochrome oxidase subunit 1 [Akebia quinata] Length = 471 Score = 104 bits (260), Expect = 1e-20 Identities = 52/65 (80%), Positives = 57/65 (87%), Gaps = 1/65 (1%) Frame = +3 Query: 45 EHLFQFFGHPDVCIPILPGSGIISHIVLTFLGKPVFG-*GMVYAMISTGVLGSLVRAHHL 221 +HLF+FFGHP+V IPILPGSGIISHIV TF GKPVFG GMVYAMISTGVLG LVRAHH+ Sbjct: 200 QHLFRFFGHPEVYIPILPGSGIISHIVSTFSGKPVFGYLGMVYAMISTGVLGFLVRAHHM 259 Query: 222 FPVAT 236 F V + Sbjct: 260 FTVGS 264 >gb|ACV81905.1| cytochrome oxidase subunit I [Scoliopus bigelovii] Length = 465 Score = 104 bits (260), Expect = 1e-20 Identities = 52/65 (80%), Positives = 57/65 (87%), Gaps = 1/65 (1%) Frame = +3 Query: 45 EHLFQFFGHPDVCIPILPGSGIISHIVLTFLGKPVFG-*GMVYAMISTGVLGSLVRAHHL 221 +HLF+FFGHP+V IPILPGSGIISHIV TF GKPVFG GMVYAMIS GVLGSLVRAHH+ Sbjct: 191 QHLFRFFGHPEVYIPILPGSGIISHIVSTFSGKPVFGYLGMVYAMISIGVLGSLVRAHHM 250 Query: 222 FPVAT 236 F V + Sbjct: 251 FTVGS 255 >gb|ACV81904.1| cytochrome oxidase subunit I [Prosartes hookeri] Length = 465 Score = 104 bits (260), Expect = 1e-20 Identities = 52/65 (80%), Positives = 57/65 (87%), Gaps = 1/65 (1%) Frame = +3 Query: 45 EHLFQFFGHPDVCIPILPGSGIISHIVLTFLGKPVFG-*GMVYAMISTGVLGSLVRAHHL 221 +HLF+FFGHP+V IPILPGSGIISHIV TF GKPVFG GMVYAMIS GVLGSLVRAHH+ Sbjct: 190 QHLFRFFGHPEVYIPILPGSGIISHIVSTFSGKPVFGYLGMVYAMISIGVLGSLVRAHHM 249 Query: 222 FPVAT 236 F V + Sbjct: 250 FTVGS 254 >gb|ACV81900.1| cytochrome oxidase subunit I [Clintonia borealis] Length = 465 Score = 104 bits (260), Expect = 1e-20 Identities = 52/65 (80%), Positives = 57/65 (87%), Gaps = 1/65 (1%) Frame = +3 Query: 45 EHLFQFFGHPDVCIPILPGSGIISHIVLTFLGKPVFG-*GMVYAMISTGVLGSLVRAHHL 221 +HLF+FFGHP+V IPILPGSGIISHIV TF GKPVFG GMVYAMIS GVLGSLVRAHH+ Sbjct: 190 QHLFRFFGHPEVYIPILPGSGIISHIVSTFSGKPVFGYLGMVYAMISIGVLGSLVRAHHM 249 Query: 222 FPVAT 236 F V + Sbjct: 250 FTVGS 254 >gb|ACV81898.1| cytochrome oxidase subunit I [Calochortus macrocarpus] Length = 453 Score = 104 bits (260), Expect = 1e-20 Identities = 52/65 (80%), Positives = 57/65 (87%), Gaps = 1/65 (1%) Frame = +3 Query: 45 EHLFQFFGHPDVCIPILPGSGIISHIVLTFLGKPVFG-*GMVYAMISTGVLGSLVRAHHL 221 +HLF+FFGHP+V IPILPGSGIISHIV TF GKPVFG GMVYAMIS GVLGSLVRAHH+ Sbjct: 179 QHLFRFFGHPEVYIPILPGSGIISHIVSTFSGKPVFGYLGMVYAMISIGVLGSLVRAHHM 238 Query: 222 FPVAT 236 F V + Sbjct: 239 FTVGS 243 >gb|AAF77676.1|AF193950_1 chytochrome oxidase subunit 1 [Nelumbo nucifera] gi|8574739|gb|AAF77685.1|AF193959_1 chytochrome oxidase subunit 1 [Liriodendron tulipifera] gi|12659443|gb|AAG60256.1| cytochrome oxidase subunit 1 [Tetracentron sinense] Length = 471 Score = 104 bits (259), Expect = 1e-20 Identities = 52/65 (80%), Positives = 57/65 (87%), Gaps = 1/65 (1%) Frame = +3 Query: 45 EHLFQFFGHPDVCIPILPGSGIISHIVLTFLGKPVFG-*GMVYAMISTGVLGSLVRAHHL 221 +HLF+FFGHP+V IPILPGSGIISHIV TF GKPVFG GMVYAMISTGV GSLVRAHH+ Sbjct: 200 QHLFRFFGHPEVYIPILPGSGIISHIVSTFSGKPVFGYLGMVYAMISTGVPGSLVRAHHM 259 Query: 222 FPVAT 236 F V + Sbjct: 260 FTVGS 264 >gb|AAD01675.1| cytochrome c oxidase [Trochodendron aralioides] Length = 471 Score = 104 bits (259), Expect = 1e-20 Identities = 52/65 (80%), Positives = 57/65 (87%), Gaps = 1/65 (1%) Frame = +3 Query: 45 EHLFQFFGHPDVCIPILPGSGIISHIVLTFLGKPVFG-*GMVYAMISTGVLGSLVRAHHL 221 +HLF+FFGHP+V IPILPGSGIISHIV TF GKPVFG GMVYAMISTGV GSLVRAHH+ Sbjct: 200 QHLFRFFGHPEVYIPILPGSGIISHIVSTFSGKPVFGYLGMVYAMISTGVPGSLVRAHHM 259 Query: 222 FPVAT 236 F V + Sbjct: 260 FTVGS 264 >gb|AAG60252.1| cytochrome oxidase subunit 1 [Ranunculus carolinianus] Length = 471 Score = 104 bits (259), Expect = 1e-20 Identities = 52/63 (82%), Positives = 56/63 (88%), Gaps = 1/63 (1%) Frame = +3 Query: 45 EHLFQFFGHPDVCIPILPGSGIISHIVLTFLGKPVFG-*GMVYAMISTGVLGSLVRAHHL 221 +HLF+FFGHP+V IPILPG GIISHIV TF GKPVFG GMVYAMISTGVLGSLVRAHH+ Sbjct: 200 QHLFRFFGHPEVYIPILPGFGIISHIVSTFSGKPVFGYLGMVYAMISTGVLGSLVRAHHM 259 Query: 222 FPV 230 F V Sbjct: 260 FTV 262 >ref|YP_007905714.1| cytochrome c oxidase subunit 1 (mitochondrion) [Liriodendron tulipifera] gi|480541918|gb|AGJ90411.1| cytochrome c oxidase subunit 1 (mitochondrion) [Liriodendron tulipifera] Length = 527 Score = 103 bits (258), Expect = 2e-20 Identities = 52/63 (82%), Positives = 56/63 (88%), Gaps = 1/63 (1%) Frame = +3 Query: 45 EHLFQFFGHPDVCIPILPGSGIISHIVLTFLGKPVFG-*GMVYAMISTGVLGSLVRAHHL 221 +HLF+FFGHP+V IPILPGSGIISHIV TF GKPVFG GMVYAMISTGV GSLVRAHH+ Sbjct: 235 QHLFRFFGHPEVYIPILPGSGIISHIVSTFSGKPVFGYLGMVYAMISTGVPGSLVRAHHM 294 Query: 222 FPV 230 F V Sbjct: 295 FTV 297 >gb|AAD01662.1| cytochrome c oxidase [Magnolia grandiflora] Length = 471 Score = 103 bits (258), Expect = 2e-20 Identities = 52/63 (82%), Positives = 56/63 (88%), Gaps = 1/63 (1%) Frame = +3 Query: 45 EHLFQFFGHPDVCIPILPGSGIISHIVLTFLGKPVFG-*GMVYAMISTGVLGSLVRAHHL 221 +HLF+FFGHP+V IPILPGSGIISHIV TF GKPVFG GMVYAMISTGV GSLVRAHH+ Sbjct: 200 QHLFRFFGHPEVYIPILPGSGIISHIVSTFSGKPVFGYLGMVYAMISTGVPGSLVRAHHM 259 Query: 222 FPV 230 F V Sbjct: 260 FTV 262 >gb|AAG60245.1| cytochrome oxidase subunit 1 [Eupomatia laurina] Length = 471 Score = 103 bits (258), Expect = 2e-20 Identities = 52/63 (82%), Positives = 56/63 (88%), Gaps = 1/63 (1%) Frame = +3 Query: 45 EHLFQFFGHPDVCIPILPGSGIISHIVLTFLGKPVFG-*GMVYAMISTGVLGSLVRAHHL 221 +HLF+FFGHP+V IPILPGSGIISHIV TF GKPVFG GMVYAMISTGV GSLVRAHH+ Sbjct: 200 QHLFRFFGHPEVYIPILPGSGIISHIVSTFSGKPVFGYLGMVYAMISTGVPGSLVRAHHM 259 Query: 222 FPV 230 F V Sbjct: 260 FTV 262 >gb|AAC98472.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Magnolia stellata] Length = 526 Score = 103 bits (258), Expect = 2e-20 Identities = 52/63 (82%), Positives = 56/63 (88%), Gaps = 1/63 (1%) Frame = +3 Query: 45 EHLFQFFGHPDVCIPILPGSGIISHIVLTFLGKPVFG-*GMVYAMISTGVLGSLVRAHHL 221 +HLF+FFGHP+V IPILPGSGIISHIV TF GKPVFG GMVYAMISTGV GSLVRAHH+ Sbjct: 235 QHLFRFFGHPEVYIPILPGSGIISHIVSTFSGKPVFGYLGMVYAMISTGVPGSLVRAHHM 294 Query: 222 FPV 230 F V Sbjct: 295 FTV 297 >gb|ABI96916.1| cytochrome oxidase subunit 1 [Liriodendron tulipifera] Length = 486 Score = 103 bits (258), Expect = 2e-20 Identities = 52/63 (82%), Positives = 56/63 (88%), Gaps = 1/63 (1%) Frame = +3 Query: 45 EHLFQFFGHPDVCIPILPGSGIISHIVLTFLGKPVFG-*GMVYAMISTGVLGSLVRAHHL 221 +HLF+FFGHP+V IPILPGSGIISHIV TF GKPVFG GMVYAMISTGV GSLVRAHH+ Sbjct: 207 QHLFRFFGHPEVYIPILPGSGIISHIVSTFSGKPVFGYLGMVYAMISTGVPGSLVRAHHM 266 Query: 222 FPV 230 F V Sbjct: 267 FTV 269 >gb|AAF77690.1|AF193964_1 chytochrome oxidase subunit 1 [Tetracentron sinense] Length = 471 Score = 103 bits (258), Expect = 2e-20 Identities = 52/63 (82%), Positives = 56/63 (88%), Gaps = 1/63 (1%) Frame = +3 Query: 45 EHLFQFFGHPDVCIPILPGSGIISHIVLTFLGKPVFG-*GMVYAMISTGVLGSLVRAHHL 221 +HLF+FFGHP+V IPILPGSGIISHIV TF GKPVFG GMVYAMISTGV GSLVRAHH+ Sbjct: 200 QHLFRFFGHPEVYIPILPGSGIISHIVSTFSGKPVFGYLGMVYAMISTGVPGSLVRAHHM 259 Query: 222 FPV 230 F V Sbjct: 260 FTV 262