BLASTX nr result
ID: Paeonia24_contig00010747
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00010747 (351 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007149962.1| hypothetical protein PHAVU_005G114100g [Phas... 67 3e-09 ref|XP_004486159.1| PREDICTED: transcription factor CPC-like [Ci... 65 1e-08 ref|XP_002280056.1| PREDICTED: transcription factor CPC [Vitis v... 64 3e-08 ref|XP_002529738.1| triptychon and cpc, putative [Ricinus commun... 63 5e-08 ref|XP_006592819.1| PREDICTED: MYB-like transcription factor ETC... 62 6e-08 ref|XP_006469704.1| PREDICTED: transcription factor CPC-like iso... 62 6e-08 gb|AHB59611.1| putative MYB-related protein 25 [Arachis hypogaea] 62 6e-08 ref|XP_006447522.1| hypothetical protein CICLE_v10017220mg [Citr... 62 6e-08 ref|XP_007026077.1| Uncharacterized protein TCM_030224 [Theobrom... 62 6e-08 ref|XP_007045608.1| Homeodomain-like superfamily protein [Theobr... 62 6e-08 ref|XP_003540314.1| PREDICTED: MYB-like transcription factor ETC... 62 6e-08 ref|XP_002518480.1| triptychon and cpc, putative [Ricinus commun... 62 6e-08 ref|XP_006593492.1| PREDICTED: MYB transcription factor MYB172 i... 62 1e-07 ref|XP_007132566.1| hypothetical protein PHAVU_011G105600g [Phas... 62 1e-07 ref|NP_001237796.1| MYB transcription factor MYB172 [Glycine max... 62 1e-07 ref|XP_006351959.1| PREDICTED: MYB-like transcription factor ETC... 61 1e-07 gb|ACU15594.1| unknown [Glycine max] 61 1e-07 ref|NP_001237778.1| MYB transcription factor MYB73 [Glycine max]... 61 1e-07 ref|XP_007216010.1| hypothetical protein PRUPE_ppa014728mg [Prun... 61 2e-07 gb|EXC23129.1| Transcription factor CPC [Morus notabilis] 60 2e-07 >ref|XP_007149962.1| hypothetical protein PHAVU_005G114100g [Phaseolus vulgaris] gi|561023226|gb|ESW21956.1| hypothetical protein PHAVU_005G114100g [Phaseolus vulgaris] Length = 75 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +1 Query: 1 FKLVGKRWSLIAGRIPGRTAEEIEKYWTSKPSS 99 +KLVGKRWSLIAGRIPGRTAEEIEKYWTSK SS Sbjct: 40 YKLVGKRWSLIAGRIPGRTAEEIEKYWTSKLSS 72 >ref|XP_004486159.1| PREDICTED: transcription factor CPC-like [Cicer arietinum] Length = 75 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +1 Query: 1 FKLVGKRWSLIAGRIPGRTAEEIEKYWTSKPSSER 105 F+LVGKRW LIAGRIPGRTAEEIEK+WTSK SS + Sbjct: 39 FRLVGKRWHLIAGRIPGRTAEEIEKFWTSKGSSSK 73 >ref|XP_002280056.1| PREDICTED: transcription factor CPC [Vitis vinifera] gi|297739299|emb|CBI28950.3| unnamed protein product [Vitis vinifera] Length = 73 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +1 Query: 1 FKLVGKRWSLIAGRIPGRTAEEIEKYWTSKPSS 99 F LVG+RWSLIAGRIPGRTAEEIEKYWTS+ SS Sbjct: 39 FNLVGERWSLIAGRIPGRTAEEIEKYWTSRYSS 71 >ref|XP_002529738.1| triptychon and cpc, putative [Ricinus communis] gi|223530779|gb|EEF32645.1| triptychon and cpc, putative [Ricinus communis] Length = 74 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +1 Query: 1 FKLVGKRWSLIAGRIPGRTAEEIEKYWTSKPSSER 105 F LVG+RWSLIAGRIPGRTAEEIEKYWTS+ S+ + Sbjct: 40 FNLVGERWSLIAGRIPGRTAEEIEKYWTSRYSTSQ 74 >ref|XP_006592819.1| PREDICTED: MYB-like transcription factor ETC1-like isoform X2 [Glycine max] Length = 75 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +1 Query: 1 FKLVGKRWSLIAGRIPGRTAEEIEKYWTSK 90 +KLVG+RWSLIAGRIPGRTAEEIEKYWTS+ Sbjct: 40 YKLVGERWSLIAGRIPGRTAEEIEKYWTSR 69 >ref|XP_006469704.1| PREDICTED: transcription factor CPC-like isoform X1 [Citrus sinensis] Length = 78 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 1 FKLVGKRWSLIAGRIPGRTAEEIEKYWTSKPSS 99 + LVGKRWSLIAGRIPGRTAEEI+KYWTS+ SS Sbjct: 43 YNLVGKRWSLIAGRIPGRTAEEIKKYWTSRYSS 75 >gb|AHB59611.1| putative MYB-related protein 25 [Arachis hypogaea] Length = 75 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 1 FKLVGKRWSLIAGRIPGRTAEEIEKYWTSKPSS 99 + LVG+RWSLIAGRIPGRTAEEIEKYWTS+ SS Sbjct: 40 YNLVGERWSLIAGRIPGRTAEEIEKYWTSRYSS 72 >ref|XP_006447522.1| hypothetical protein CICLE_v10017220mg [Citrus clementina] gi|557550133|gb|ESR60762.1| hypothetical protein CICLE_v10017220mg [Citrus clementina] Length = 116 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 1 FKLVGKRWSLIAGRIPGRTAEEIEKYWTSKPSS 99 + LVGKRWSLIAGRIPGRTAEEI+KYWTS+ SS Sbjct: 81 YNLVGKRWSLIAGRIPGRTAEEIKKYWTSRYSS 113 >ref|XP_007026077.1| Uncharacterized protein TCM_030224 [Theobroma cacao] gi|508781443|gb|EOY28699.1| Uncharacterized protein TCM_030224 [Theobroma cacao] Length = 81 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +1 Query: 1 FKLVGKRWSLIAGRIPGRTAEEIEKYWTSKPSSE 102 F L+G RWSLIAGRIPGRTA+EIEKYWTS+ SS+ Sbjct: 42 FNLIGDRWSLIAGRIPGRTADEIEKYWTSRRSSQ 75 >ref|XP_007045608.1| Homeodomain-like superfamily protein [Theobroma cacao] gi|508709543|gb|EOY01440.1| Homeodomain-like superfamily protein [Theobroma cacao] Length = 73 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 1 FKLVGKRWSLIAGRIPGRTAEEIEKYWTSKPSS 99 F LVG+RWSLIAGRIPGRTAEEIEKYWTS+ S+ Sbjct: 39 FNLVGERWSLIAGRIPGRTAEEIEKYWTSRYST 71 >ref|XP_003540314.1| PREDICTED: MYB-like transcription factor ETC1-like isoform X1 [Glycine max] Length = 73 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +1 Query: 1 FKLVGKRWSLIAGRIPGRTAEEIEKYWTSK 90 +KLVG+RWSLIAGRIPGRTAEEIEKYWTS+ Sbjct: 38 YKLVGERWSLIAGRIPGRTAEEIEKYWTSR 67 >ref|XP_002518480.1| triptychon and cpc, putative [Ricinus communis] gi|223542325|gb|EEF43867.1| triptychon and cpc, putative [Ricinus communis] Length = 77 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 1 FKLVGKRWSLIAGRIPGRTAEEIEKYWTSKPSS 99 F LVG+RWSLIAGRIPGRTAEEIEKYW +K SS Sbjct: 41 FSLVGERWSLIAGRIPGRTAEEIEKYWATKDSS 73 >ref|XP_006593492.1| PREDICTED: MYB transcription factor MYB172 isoform X1 [Glycine max] Length = 75 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +1 Query: 1 FKLVGKRWSLIAGRIPGRTAEEIEKYWTSK 90 +KLVG+RWS+IAGRIPGRTAEEIEKYWTS+ Sbjct: 40 YKLVGERWSIIAGRIPGRTAEEIEKYWTSR 69 >ref|XP_007132566.1| hypothetical protein PHAVU_011G105600g [Phaseolus vulgaris] gi|561005566|gb|ESW04560.1| hypothetical protein PHAVU_011G105600g [Phaseolus vulgaris] Length = 73 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +1 Query: 1 FKLVGKRWSLIAGRIPGRTAEEIEKYWTSKPSSER 105 + LVG+RWSLIAGRIPGRTAEEIEKYWTS+ S+ + Sbjct: 39 YNLVGERWSLIAGRIPGRTAEEIEKYWTSRYSTSQ 73 >ref|NP_001237796.1| MYB transcription factor MYB172 [Glycine max] gi|110931776|gb|ABH02887.1| MYB transcription factor MYB172 [Glycine max] Length = 73 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +1 Query: 1 FKLVGKRWSLIAGRIPGRTAEEIEKYWTSK 90 +KLVG+RWS+IAGRIPGRTAEEIEKYWTS+ Sbjct: 38 YKLVGERWSIIAGRIPGRTAEEIEKYWTSR 67 >ref|XP_006351959.1| PREDICTED: MYB-like transcription factor ETC1-like [Solanum tuberosum] Length = 78 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +1 Query: 1 FKLVGKRWSLIAGRIPGRTAEEIEKYWTSKPSSER 105 F LVG+RWSLIAGRIPGRTAEEIEKYW S+ S+ + Sbjct: 44 FNLVGERWSLIAGRIPGRTAEEIEKYWNSRNSTSQ 78 >gb|ACU15594.1| unknown [Glycine max] Length = 73 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +1 Query: 1 FKLVGKRWSLIAGRIPGRTAEEIEKYWTSKPSSER 105 + LVG+RWSLIAGRIPGRTAEEIEKYWTS+ S+ + Sbjct: 39 YNLVGERWSLIAGRIPGRTAEEIEKYWTSRFSTSQ 73 >ref|NP_001237778.1| MYB transcription factor MYB73 [Glycine max] gi|110931738|gb|ABH02868.1| MYB transcription factor MYB73 [Glycine max] gi|255630141|gb|ACU15424.1| unknown [Glycine max] Length = 74 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +1 Query: 1 FKLVGKRWSLIAGRIPGRTAEEIEKYWTSKPSSER 105 + LVG+RWSLIAGRIPGRTAEEIEKYWTS+ S+ + Sbjct: 40 YNLVGERWSLIAGRIPGRTAEEIEKYWTSRFSTSQ 74 >ref|XP_007216010.1| hypothetical protein PRUPE_ppa014728mg [Prunus persica] gi|462412160|gb|EMJ17209.1| hypothetical protein PRUPE_ppa014728mg [Prunus persica] Length = 74 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +1 Query: 1 FKLVGKRWSLIAGRIPGRTAEEIEKYWTSKPSS 99 F LVG+RWSLIAGRIPGR+AEEIEKYWTS+ S+ Sbjct: 40 FNLVGERWSLIAGRIPGRSAEEIEKYWTSRYST 72 >gb|EXC23129.1| Transcription factor CPC [Morus notabilis] Length = 73 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = +1 Query: 1 FKLVGKRWSLIAGRIPGRTAEEIEKYWTSKPSSER 105 F LVG+RW+LIAGRIPGRTAEEIEKYWT++ S+ + Sbjct: 39 FNLVGERWTLIAGRIPGRTAEEIEKYWTTRYSTSQ 73