BLASTX nr result
ID: Paeonia24_contig00010709
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00010709 (225 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAL00974.1|AF402698_1 NBS/LRR resistance protein-like protein... 108 8e-22 ref|XP_007010957.1| LRR and NB-ARC domains-containing disease re... 106 3e-21 ref|XP_007010938.1| LRR and NB-ARC domains-containing disease re... 106 4e-21 ref|XP_007010959.1| LRR and NB-ARC domains-containing disease re... 105 5e-21 ref|XP_007010934.1| LRR and NB-ARC domains-containing disease re... 105 7e-21 gb|AAL01029.1|AF402762_1 NBS/LRR resistance protein-like protein... 105 9e-21 ref|XP_007010935.1| LRR and NB-ARC domains-containing disease re... 104 1e-20 ref|XP_007010940.1| NB-ARC domain-containing disease resistance ... 103 2e-20 gb|AAL00984.1|AF402711_1 NBS/LRR resistance protein-like protein... 103 2e-20 gb|AAL00997.1|AF402725_1 NBS/LRR resistance protein-like protein... 103 3e-20 gb|AAL00986.1|AF402714_1 NBS/LRR resistance protein-like protein... 103 3e-20 gb|AAL00995.1|AF402723_1 NBS/LRR resistance protein-like protein... 103 3e-20 gb|AAL01004.1|AF402735_1 NBS/LRR resistance protein-like protein... 103 3e-20 gb|AAL00991.1|AF402719_1 NBS/LRR resistance protein-like protein... 103 3e-20 gb|AAL00994.1|AF402722_1 NBS/LRR resistance protein-like protein... 103 3e-20 gb|AAL01006.1|AF402737_1 NBS/LRR resistance protein-like protein... 100 2e-19 ref|XP_007036175.1| NB-ARC domain-containing disease resistance ... 100 2e-19 ref|XP_007010954.1| LRR and NB-ARC domains-containing disease re... 100 2e-19 ref|XP_007010950.1| LRR and NB-ARC domains-containing disease re... 100 2e-19 ref|XP_003634900.1| PREDICTED: uncharacterized protein LOC100854... 100 2e-19 >gb|AAL00974.1|AF402698_1 NBS/LRR resistance protein-like protein [Theobroma cacao] Length = 173 Score = 108 bits (270), Expect = 8e-22 Identities = 52/71 (73%), Positives = 57/71 (80%) Frame = -3 Query: 220 YFDLKAWVCVSEEFDIIRVTKAILESFTSHSPDVTTLNSLQERLVEKLSKKKFLLVLDDV 41 YFDLKAWVCVS EFD+I++TK ILES TS S D+ LN LQ +L EKLS KKFLLVLDDV Sbjct: 21 YFDLKAWVCVSNEFDVIKITKTILESVTSQSCDIHDLNLLQVKLKEKLSSKKFLLVLDDV 80 Query: 40 WLENYDKWTAL 8 W ENYD WT L Sbjct: 81 WNENYDDWTKL 91 >ref|XP_007010957.1| LRR and NB-ARC domains-containing disease resistance protein, putative [Theobroma cacao] gi|508727870|gb|EOY19767.1| LRR and NB-ARC domains-containing disease resistance protein, putative [Theobroma cacao] Length = 975 Score = 106 bits (265), Expect = 3e-21 Identities = 50/71 (70%), Positives = 58/71 (81%) Frame = -3 Query: 220 YFDLKAWVCVSEEFDIIRVTKAILESFTSHSPDVTTLNSLQERLVEKLSKKKFLLVLDDV 41 +FDLKAWVCVS+EFD+++VTK IL+S TS S D+ LN LQ +L EKLS KKFLLVLDDV Sbjct: 147 HFDLKAWVCVSDEFDVVKVTKIILQSVTSESCDINDLNLLQVKLKEKLSSKKFLLVLDDV 206 Query: 40 WLENYDKWTAL 8 W ENYD WT L Sbjct: 207 WNENYDDWTKL 217 >ref|XP_007010938.1| LRR and NB-ARC domains-containing disease resistance protein, putative [Theobroma cacao] gi|508727851|gb|EOY19748.1| LRR and NB-ARC domains-containing disease resistance protein, putative [Theobroma cacao] Length = 1361 Score = 106 bits (264), Expect = 4e-21 Identities = 51/71 (71%), Positives = 57/71 (80%) Frame = -3 Query: 220 YFDLKAWVCVSEEFDIIRVTKAILESFTSHSPDVTTLNSLQERLVEKLSKKKFLLVLDDV 41 YFDLKAWVCVS EFD+I+VTK IL+S TS S D+ LN LQ +L EKLS KKFLLVLDDV Sbjct: 224 YFDLKAWVCVSNEFDVIKVTKIILQSVTSESCDINDLNLLQVKLKEKLSSKKFLLVLDDV 283 Query: 40 WLENYDKWTAL 8 W ENY+ WT L Sbjct: 284 WNENYNDWTKL 294 >ref|XP_007010959.1| LRR and NB-ARC domains-containing disease resistance protein, putative [Theobroma cacao] gi|508727872|gb|EOY19769.1| LRR and NB-ARC domains-containing disease resistance protein, putative [Theobroma cacao] Length = 1255 Score = 105 bits (263), Expect = 5e-21 Identities = 52/71 (73%), Positives = 55/71 (77%) Frame = -3 Query: 220 YFDLKAWVCVSEEFDIIRVTKAILESFTSHSPDVTTLNSLQERLVEKLSKKKFLLVLDDV 41 YFDLKAWVCVS EFD+I++TK ILES TS S D LNSLQ L E LS KKFLLVLDDV Sbjct: 182 YFDLKAWVCVSNEFDVIKITKTILESVTSQSCDRNDLNSLQVELKENLSGKKFLLVLDDV 241 Query: 40 WLENYDKWTAL 8 W ENYD WT L Sbjct: 242 WNENYDDWTKL 252 >ref|XP_007010934.1| LRR and NB-ARC domains-containing disease resistance protein, putative [Theobroma cacao] gi|508727847|gb|EOY19744.1| LRR and NB-ARC domains-containing disease resistance protein, putative [Theobroma cacao] Length = 1440 Score = 105 bits (262), Expect = 7e-21 Identities = 50/71 (70%), Positives = 57/71 (80%) Frame = -3 Query: 220 YFDLKAWVCVSEEFDIIRVTKAILESFTSHSPDVTTLNSLQERLVEKLSKKKFLLVLDDV 41 YFDLKAWVCVSE+FD+++VTK IL+S TS DV LN LQ +L EKL KKKFLLVLDDV Sbjct: 263 YFDLKAWVCVSEDFDVVKVTKTILQSITSEPCDVNDLNLLQVKLKEKLFKKKFLLVLDDV 322 Query: 40 WLENYDKWTAL 8 W ENY+ WT L Sbjct: 323 WNENYNDWTIL 333 >gb|AAL01029.1|AF402762_1 NBS/LRR resistance protein-like protein [Theobroma cacao] Length = 174 Score = 105 bits (261), Expect = 9e-21 Identities = 51/71 (71%), Positives = 55/71 (77%) Frame = -3 Query: 220 YFDLKAWVCVSEEFDIIRVTKAILESFTSHSPDVTTLNSLQERLVEKLSKKKFLLVLDDV 41 YFDLKAWVCVS EFD+I++TK ILES TS S + LNSLQ L E LS KKFLLVLDDV Sbjct: 22 YFDLKAWVCVSNEFDVIKITKTILESVTSQSCNKNDLNSLQVELKENLSSKKFLLVLDDV 81 Query: 40 WLENYDKWTAL 8 W ENYD WT L Sbjct: 82 WNENYDDWTKL 92 >ref|XP_007010935.1| LRR and NB-ARC domains-containing disease resistance protein, putative [Theobroma cacao] gi|508727848|gb|EOY19745.1| LRR and NB-ARC domains-containing disease resistance protein, putative [Theobroma cacao] Length = 1241 Score = 104 bits (259), Expect = 1e-20 Identities = 50/71 (70%), Positives = 57/71 (80%) Frame = -3 Query: 220 YFDLKAWVCVSEEFDIIRVTKAILESFTSHSPDVTTLNSLQERLVEKLSKKKFLLVLDDV 41 YF+LKAWVCVS+EFD+I++TK ILES T S D+ LN LQ +L EKLS KKFLLVLDDV Sbjct: 228 YFNLKAWVCVSDEFDVIKITKTILESVTFQSCDIHDLNLLQVKLKEKLSGKKFLLVLDDV 287 Query: 40 WLENYDKWTAL 8 W ENYD WT L Sbjct: 288 WNENYDDWTKL 298 >ref|XP_007010940.1| NB-ARC domain-containing disease resistance protein [Theobroma cacao] gi|508727853|gb|EOY19750.1| NB-ARC domain-containing disease resistance protein [Theobroma cacao] Length = 318 Score = 103 bits (258), Expect = 2e-20 Identities = 48/71 (67%), Positives = 56/71 (78%) Frame = -3 Query: 220 YFDLKAWVCVSEEFDIIRVTKAILESFTSHSPDVTTLNSLQERLVEKLSKKKFLLVLDDV 41 +FD KAWVC+S+EFD+I++TK ILES TS S + LN LQ RL E+LS KKFLLVLDDV Sbjct: 187 HFDFKAWVCISDEFDVIKITKTILESITSQSSNTNDLNLLQVRLKEQLSSKKFLLVLDDV 246 Query: 40 WLENYDKWTAL 8 W ENYD WT L Sbjct: 247 WNENYDDWTKL 257 >gb|AAL00984.1|AF402711_1 NBS/LRR resistance protein-like protein [Theobroma cacao] Length = 172 Score = 103 bits (258), Expect = 2e-20 Identities = 50/71 (70%), Positives = 55/71 (77%) Frame = -3 Query: 220 YFDLKAWVCVSEEFDIIRVTKAILESFTSHSPDVTTLNSLQERLVEKLSKKKFLLVLDDV 41 YFDLKAWVCVS EFD+I++TK ILES T D+ LN LQ +L EKLS KKFLLVLDDV Sbjct: 20 YFDLKAWVCVSNEFDVIKITKTILESVTFQYCDIHDLNLLQVKLKEKLSSKKFLLVLDDV 79 Query: 40 WLENYDKWTAL 8 W ENYD WT L Sbjct: 80 WNENYDDWTKL 90 >gb|AAL00997.1|AF402725_1 NBS/LRR resistance protein-like protein [Theobroma cacao] Length = 173 Score = 103 bits (256), Expect = 3e-20 Identities = 50/71 (70%), Positives = 54/71 (76%) Frame = -3 Query: 220 YFDLKAWVCVSEEFDIIRVTKAILESFTSHSPDVTTLNSLQERLVEKLSKKKFLLVLDDV 41 YFDL+ WVCVS EFD+I++TK ILES TS S D LNSLQ L E LS KKFLLVLDDV Sbjct: 21 YFDLRVWVCVSNEFDVIKITKTILESVTSQSCDRNDLNSLQVELKENLSGKKFLLVLDDV 80 Query: 40 WLENYDKWTAL 8 W ENYD WT L Sbjct: 81 WNENYDDWTKL 91 >gb|AAL00986.1|AF402714_1 NBS/LRR resistance protein-like protein [Theobroma cacao] Length = 174 Score = 103 bits (256), Expect = 3e-20 Identities = 50/71 (70%), Positives = 54/71 (76%) Frame = -3 Query: 220 YFDLKAWVCVSEEFDIIRVTKAILESFTSHSPDVTTLNSLQERLVEKLSKKKFLLVLDDV 41 YFDL+ WVCVS EFD+I++TK ILES TS S D LNSLQ L E LS KKFLLVLDDV Sbjct: 22 YFDLRVWVCVSNEFDVIKITKTILESVTSQSCDRNDLNSLQVELKENLSGKKFLLVLDDV 81 Query: 40 WLENYDKWTAL 8 W ENYD WT L Sbjct: 82 WNENYDDWTKL 92 >gb|AAL00995.1|AF402723_1 NBS/LRR resistance protein-like protein [Theobroma cacao] Length = 173 Score = 103 bits (256), Expect = 3e-20 Identities = 51/71 (71%), Positives = 54/71 (76%) Frame = -3 Query: 220 YFDLKAWVCVSEEFDIIRVTKAILESFTSHSPDVTTLNSLQERLVEKLSKKKFLLVLDDV 41 YFDLKAWVCVS EFD+I+ TK ILES TS S + LNSLQ L E LS KKFLLVLDDV Sbjct: 21 YFDLKAWVCVSNEFDVIKTTKTILESVTSQSCNKNDLNSLQVELKENLSGKKFLLVLDDV 80 Query: 40 WLENYDKWTAL 8 W ENYD WT L Sbjct: 81 WNENYDDWTKL 91 >gb|AAL01004.1|AF402735_1 NBS/LRR resistance protein-like protein [Theobroma cacao] Length = 175 Score = 103 bits (256), Expect = 3e-20 Identities = 50/71 (70%), Positives = 54/71 (76%) Frame = -3 Query: 220 YFDLKAWVCVSEEFDIIRVTKAILESFTSHSPDVTTLNSLQERLVEKLSKKKFLLVLDDV 41 YFDL+ WVCVS EFD+I++TK ILES TS S D LNSLQ L E LS KKFLLVLDDV Sbjct: 23 YFDLRVWVCVSNEFDVIKITKTILESVTSQSCDRNDLNSLQVELKENLSGKKFLLVLDDV 82 Query: 40 WLENYDKWTAL 8 W ENYD WT L Sbjct: 83 WNENYDDWTKL 93 >gb|AAL00991.1|AF402719_1 NBS/LRR resistance protein-like protein [Theobroma cacao] Length = 174 Score = 103 bits (256), Expect = 3e-20 Identities = 50/71 (70%), Positives = 54/71 (76%) Frame = -3 Query: 220 YFDLKAWVCVSEEFDIIRVTKAILESFTSHSPDVTTLNSLQERLVEKLSKKKFLLVLDDV 41 YFDL+ WVCVS EFD+I++TK ILES TS S D LNSLQ L E LS KKFLLVLDDV Sbjct: 22 YFDLRVWVCVSNEFDVIKITKTILESVTSQSCDRNDLNSLQVELKENLSGKKFLLVLDDV 81 Query: 40 WLENYDKWTAL 8 W ENYD WT L Sbjct: 82 WNENYDDWTKL 92 >gb|AAL00994.1|AF402722_1 NBS/LRR resistance protein-like protein [Theobroma cacao] Length = 173 Score = 103 bits (256), Expect = 3e-20 Identities = 51/71 (71%), Positives = 54/71 (76%) Frame = -3 Query: 220 YFDLKAWVCVSEEFDIIRVTKAILESFTSHSPDVTTLNSLQERLVEKLSKKKFLLVLDDV 41 YFDLKAWVCVS EFD+I+ TK ILES TS S + LNSLQ L E LS KKFLLVLDDV Sbjct: 21 YFDLKAWVCVSNEFDVIKTTKTILESVTSQSCNKNDLNSLQVELKENLSGKKFLLVLDDV 80 Query: 40 WLENYDKWTAL 8 W ENYD WT L Sbjct: 81 WNENYDDWTKL 91 >gb|AAL01006.1|AF402737_1 NBS/LRR resistance protein-like protein [Theobroma cacao] Length = 173 Score = 100 bits (250), Expect = 2e-19 Identities = 49/71 (69%), Positives = 54/71 (76%) Frame = -3 Query: 220 YFDLKAWVCVSEEFDIIRVTKAILESFTSHSPDVTTLNSLQERLVEKLSKKKFLLVLDDV 41 YFDLKAWVCVS EFD+I++TK ILES TS S + LN LQ L E LS +KFLLVLDDV Sbjct: 21 YFDLKAWVCVSNEFDVIKITKTILESVTSQSCNKNDLNLLQVELKENLSGRKFLLVLDDV 80 Query: 40 WLENYDKWTAL 8 W ENYD WT L Sbjct: 81 WNENYDDWTKL 91 >ref|XP_007036175.1| NB-ARC domain-containing disease resistance protein [Theobroma cacao] gi|508773420|gb|EOY20676.1| NB-ARC domain-containing disease resistance protein [Theobroma cacao] Length = 340 Score = 100 bits (249), Expect = 2e-19 Identities = 49/72 (68%), Positives = 55/72 (76%) Frame = -3 Query: 223 GYFDLKAWVCVSEEFDIIRVTKAILESFTSHSPDVTTLNSLQERLVEKLSKKKFLLVLDD 44 GYFDLKAWVCVSEEFD+I++TK IL+S S S D+ LN LQ L EKLS KKFLLVLDD Sbjct: 156 GYFDLKAWVCVSEEFDVIKITKIILQSVRSLSCDINDLNLLQVSLKEKLSSKKFLLVLDD 215 Query: 43 VWLENYDKWTAL 8 VW +NY W L Sbjct: 216 VWNKNYIDWMTL 227 >ref|XP_007010954.1| LRR and NB-ARC domains-containing disease resistance protein, putative [Theobroma cacao] gi|508727867|gb|EOY19764.1| LRR and NB-ARC domains-containing disease resistance protein, putative [Theobroma cacao] Length = 1304 Score = 100 bits (249), Expect = 2e-19 Identities = 49/71 (69%), Positives = 54/71 (76%) Frame = -3 Query: 220 YFDLKAWVCVSEEFDIIRVTKAILESFTSHSPDVTTLNSLQERLVEKLSKKKFLLVLDDV 41 YFDLKAWVCVS EFD+I++TK ILES TS S + LNSLQ L + L KKFLLVLDDV Sbjct: 166 YFDLKAWVCVSNEFDVIKITKTILESVTSQSCNKNDLNSLQVELKKNLLGKKFLLVLDDV 225 Query: 40 WLENYDKWTAL 8 W ENYD WT L Sbjct: 226 WNENYDDWTKL 236 >ref|XP_007010950.1| LRR and NB-ARC domains-containing disease resistance protein, putative [Theobroma cacao] gi|508727863|gb|EOY19760.1| LRR and NB-ARC domains-containing disease resistance protein, putative [Theobroma cacao] Length = 1135 Score = 100 bits (249), Expect = 2e-19 Identities = 47/71 (66%), Positives = 55/71 (77%) Frame = -3 Query: 220 YFDLKAWVCVSEEFDIIRVTKAILESFTSHSPDVTTLNSLQERLVEKLSKKKFLLVLDDV 41 +FDLKAWVCVS EFD+I++TK ILES T D+T LN LQ +L EKLS+KKFL VLDDV Sbjct: 224 HFDLKAWVCVSHEFDVIKITKTILESVTFEPCDITDLNLLQFKLKEKLSRKKFLFVLDDV 283 Query: 40 WLENYDKWTAL 8 W ENY+ W L Sbjct: 284 WTENYNDWMRL 294 >ref|XP_003634900.1| PREDICTED: uncharacterized protein LOC100854556 [Vitis vinifera] Length = 2204 Score = 100 bits (249), Expect = 2e-19 Identities = 44/71 (61%), Positives = 58/71 (81%) Frame = -3 Query: 220 YFDLKAWVCVSEEFDIIRVTKAILESFTSHSPDVTTLNSLQERLVEKLSKKKFLLVLDDV 41 +FDL+AWVCVS++FD++R+TK +L+S S++ ++ LN LQ +L EKLS KKFLLVLDDV Sbjct: 233 HFDLRAWVCVSDDFDVLRITKTLLQSIASYAREINDLNLLQVKLKEKLSGKKFLLVLDDV 292 Query: 40 WLENYDKWTAL 8 W ENYDKW L Sbjct: 293 WNENYDKWDRL 303