BLASTX nr result
ID: Paeonia24_contig00010363
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00010363 (234 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCH50976.1| T4.15 [Malus x robusta] 79 9e-13 gb|ABN08628.1| RNA-directed DNA polymerase (Reverse transcriptas... 77 3e-12 emb|CBL94163.1| putative RNA-directed DNA polymerase (Reverse tr... 76 6e-12 gb|EMT19471.1| Putative isoaspartyl peptidase/L-asparaginase 3 [... 74 2e-11 gb|AEL30371.1| TIR-NBS-LRR type disease resistance protein [Arac... 73 5e-11 gb|EMT09105.1| Putative RNA-directed DNA polymerase from transpo... 72 6e-11 gb|AEL30343.1| RNA-directed DNA polymerase [Arachis hypogaea] 72 6e-11 gb|EMT14674.1| Methyltransferase-like protein 13 [Aegilops tausc... 72 8e-11 gb|ABD28426.2| RNA-directed DNA polymerase (Reverse transcriptas... 71 1e-10 gb|EMS53784.1| IAA-alanine resistance protein 1 [Triticum urartu] 70 3e-10 gb|EMS45856.1| Cystathionine gamma-synthase, chloroplastic [Trit... 70 3e-10 gb|EYC35814.1| hypothetical protein Y032_0975g3266 [Ancylostoma ... 70 4e-10 emb|CDJ80644.1| Endonuclease exonuclease phosphatase and RNA-dir... 70 4e-10 emb|CDJ90886.1| Endonuclease exonuclease phosphatase and RNA-dir... 70 4e-10 gb|EYC46303.1| hypothetical protein Y032_0402g814 [Ancylostoma c... 69 5e-10 gb|EYC46273.1| hypothetical protein Y032_0402g801 [Ancylostoma c... 69 5e-10 gb|EYC43100.1| hypothetical protein Y032_0503g2638 [Ancylostoma ... 69 5e-10 gb|EYC40457.1| hypothetical protein Y032_0611g633 [Ancylostoma c... 69 5e-10 gb|EYC39011.1| hypothetical protein Y032_0681g1482 [Ancylostoma ... 69 5e-10 gb|EYC36392.1| hypothetical protein Y032_0900g2943 [Ancylostoma ... 69 5e-10 >emb|CCH50976.1| T4.15 [Malus x robusta] Length = 986 Score = 78.6 bits (192), Expect = 9e-13 Identities = 31/52 (59%), Positives = 43/52 (82%) Frame = -2 Query: 158 ALRRMSAGRALGPDGVPIEVWKIMGEVGLGWLTRLFNKIIATRRMPNEWRRS 3 AL++M +A+GPD +PIEVWK++GE G+ WLT LFN+I+ T++MPNEWR S Sbjct: 568 ALKKMKHRKAIGPDDIPIEVWKVLGETGITWLTDLFNRILKTKKMPNEWRTS 619 >gb|ABN08628.1| RNA-directed DNA polymerase (Reverse transcriptase) [Medicago truncatula] Length = 243 Score = 77.0 bits (188), Expect = 3e-12 Identities = 32/52 (61%), Positives = 45/52 (86%) Frame = -2 Query: 158 ALRRMSAGRALGPDGVPIEVWKIMGEVGLGWLTRLFNKIIATRRMPNEWRRS 3 AL+RMS G+A+GPD +PIEVWK +G+ G+ WLT+LFN+I+ T++M +EWRRS Sbjct: 25 ALKRMSNGKAVGPDNIPIEVWKSLGDRGIVWLTKLFNEIMKTKKMLDEWRRS 76 >emb|CBL94163.1| putative RNA-directed DNA polymerase (Reverse transcriptase) [Malus domestica] Length = 622 Score = 75.9 bits (185), Expect = 6e-12 Identities = 30/52 (57%), Positives = 42/52 (80%) Frame = -2 Query: 158 ALRRMSAGRALGPDGVPIEVWKIMGEVGLGWLTRLFNKIIATRRMPNEWRRS 3 AL++M +A+GPD +PIEVWK++GE G+ WL LFN+I+ T++MPNEWR S Sbjct: 172 ALKKMKHRKAVGPDDIPIEVWKVLGETGITWLIDLFNRILKTKKMPNEWRTS 223 >gb|EMT19471.1| Putative isoaspartyl peptidase/L-asparaginase 3 [Aegilops tauschii] Length = 622 Score = 74.3 bits (181), Expect = 2e-11 Identities = 30/52 (57%), Positives = 40/52 (76%) Frame = -2 Query: 158 ALRRMSAGRALGPDGVPIEVWKIMGEVGLGWLTRLFNKIIATRRMPNEWRRS 3 AL+RM G+A+GPD +PIEVWK +G++ + WLT+LFN I +MP EWRRS Sbjct: 455 ALKRMKGGKAMGPDRIPIEVWKGLGDIAIVWLTKLFNLIFRANKMPEEWRRS 506 >gb|AEL30371.1| TIR-NBS-LRR type disease resistance protein [Arachis hypogaea] Length = 1939 Score = 72.8 bits (177), Expect = 5e-11 Identities = 29/52 (55%), Positives = 43/52 (82%) Frame = -2 Query: 158 ALRRMSAGRALGPDGVPIEVWKIMGEVGLGWLTRLFNKIIATRRMPNEWRRS 3 AL++M GRA+GPD +PIEVWK +G G+ WLT+LF +I+ +++MP+EWR+S Sbjct: 967 ALKQMKNGRAVGPDNIPIEVWKGLGGKGINWLTKLFYEILRSKKMPDEWRKS 1018 >gb|EMT09105.1| Putative RNA-directed DNA polymerase from transposon BS [Aegilops tauschii] Length = 1476 Score = 72.4 bits (176), Expect = 6e-11 Identities = 29/52 (55%), Positives = 39/52 (75%) Frame = -2 Query: 158 ALRRMSAGRALGPDGVPIEVWKIMGEVGLGWLTRLFNKIIATRRMPNEWRRS 3 AL+RM G+ +GPD +PIEVWK +G++ + WLT+LFN I +MP EWRRS Sbjct: 894 ALKRMKGGKVMGPDCIPIEVWKGLGDIAIVWLTKLFNLIFRANKMPEEWRRS 945 >gb|AEL30343.1| RNA-directed DNA polymerase [Arachis hypogaea] Length = 562 Score = 72.4 bits (176), Expect = 6e-11 Identities = 29/52 (55%), Positives = 41/52 (78%) Frame = -2 Query: 158 ALRRMSAGRALGPDGVPIEVWKIMGEVGLGWLTRLFNKIIATRRMPNEWRRS 3 AL +M RA+GPD +PIEVWK +GE + WLT+LFN+I+ +++MP EWR+S Sbjct: 62 ALNQMKNDRAVGPDNIPIEVWKDLGEKDINWLTKLFNEILRSKKMPGEWRKS 113 >gb|EMT14674.1| Methyltransferase-like protein 13 [Aegilops tauschii] Length = 1134 Score = 72.0 bits (175), Expect = 8e-11 Identities = 29/57 (50%), Positives = 41/57 (71%) Frame = -2 Query: 173 LLHQYALRRMSAGRALGPDGVPIEVWKIMGEVGLGWLTRLFNKIIATRRMPNEWRRS 3 ++ +Y RM G+A+GPD +PIEVWK +G++ + WLT+LFN I +MP EWRRS Sbjct: 316 IVPKYQSSRMKGGKAMGPDCIPIEVWKGLGDIAIVWLTKLFNLIFRANKMPEEWRRS 372 >gb|ABD28426.2| RNA-directed DNA polymerase (Reverse transcriptase) [Medicago truncatula] Length = 517 Score = 71.2 bits (173), Expect = 1e-10 Identities = 30/52 (57%), Positives = 40/52 (76%) Frame = -2 Query: 158 ALRRMSAGRALGPDGVPIEVWKIMGEVGLGWLTRLFNKIIATRRMPNEWRRS 3 AL+RM + A+GPD +PIEVWK +G+ G WL LFN+II T++M +EWRRS Sbjct: 150 ALKRMGSDEAVGPDNIPIEVWKSLGDRGTVWLANLFNEIIRTKKMSDEWRRS 201 >gb|EMS53784.1| IAA-alanine resistance protein 1 [Triticum urartu] Length = 722 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/52 (55%), Positives = 39/52 (75%) Frame = -2 Query: 158 ALRRMSAGRALGPDGVPIEVWKIMGEVGLGWLTRLFNKIIATRRMPNEWRRS 3 AL+RM G+A+G D +PIEVWK +G++ + WLT+LFN I +MP EWRRS Sbjct: 460 ALKRMKGGKAMGLDCIPIEVWKGLGDIAIVWLTKLFNLIFRANKMPGEWRRS 511 >gb|EMS45856.1| Cystathionine gamma-synthase, chloroplastic [Triticum urartu] Length = 723 Score = 70.1 bits (170), Expect = 3e-10 Identities = 28/52 (53%), Positives = 38/52 (73%) Frame = -2 Query: 158 ALRRMSAGRALGPDGVPIEVWKIMGEVGLGWLTRLFNKIIATRRMPNEWRRS 3 AL+RM + +GPD +PIEVWK +G++ + WLT+LFN I +MP EWRRS Sbjct: 354 ALKRMKGSKVMGPDCIPIEVWKGLGDIAIVWLTKLFNLIFRANKMPEEWRRS 405 >gb|EYC35814.1| hypothetical protein Y032_0975g3266 [Ancylostoma ceylanicum] Length = 198 Score = 69.7 bits (169), Expect = 4e-10 Identities = 26/52 (50%), Positives = 39/52 (75%) Frame = -2 Query: 158 ALRRMSAGRALGPDGVPIEVWKIMGEVGLGWLTRLFNKIIATRRMPNEWRRS 3 A++++ AGRA GPDG+P+E W+ +GE+G+ WLT+ FN I + +MP WR S Sbjct: 78 AIKKVKAGRATGPDGIPVEAWRSLGELGVRWLTKFFNNITRSAKMPEAWRDS 129 >emb|CDJ80644.1| Endonuclease exonuclease phosphatase and RNA-directed DNA polymerase (reverse transcriptase) domain containing protein [Haemonchus contortus] Length = 816 Score = 69.7 bits (169), Expect = 4e-10 Identities = 29/52 (55%), Positives = 37/52 (71%) Frame = -2 Query: 158 ALRRMSAGRALGPDGVPIEVWKIMGEVGLGWLTRLFNKIIATRRMPNEWRRS 3 A+ +M G+A GPDGVPIE WK +GE G+ WLTR N + A R+P+ WRRS Sbjct: 476 AIGKMKVGKATGPDGVPIEAWKALGEHGIKWLTRFLNTVTAEGRIPDAWRRS 527 >emb|CDJ90886.1| Endonuclease exonuclease phosphatase and RNA-directed DNA polymerase (reverse transcriptase) domain containing protein [Haemonchus contortus] Length = 520 Score = 69.7 bits (169), Expect = 4e-10 Identities = 29/52 (55%), Positives = 37/52 (71%) Frame = -2 Query: 158 ALRRMSAGRALGPDGVPIEVWKIMGEVGLGWLTRLFNKIIATRRMPNEWRRS 3 A+ +M G+A GPDGVPIE WK +GE G+ WLTR N + A R+P+ WRRS Sbjct: 334 AIGKMKVGKATGPDGVPIEAWKALGEHGIKWLTRFLNTVTAKGRIPDAWRRS 385 >gb|EYC46303.1| hypothetical protein Y032_0402g814 [Ancylostoma ceylanicum] Length = 986 Score = 69.3 bits (168), Expect = 5e-10 Identities = 26/52 (50%), Positives = 38/52 (73%) Frame = -2 Query: 158 ALRRMSAGRALGPDGVPIEVWKIMGEVGLGWLTRLFNKIIATRRMPNEWRRS 3 A+++M AG+A GPDG+P+E W+ +GE+G+ WLT FN I + +MP WR S Sbjct: 505 AIKKMKAGKATGPDGIPVEAWRSLGELGVRWLTEFFNNITRSAKMPEAWRDS 556 >gb|EYC46273.1| hypothetical protein Y032_0402g801 [Ancylostoma ceylanicum] Length = 982 Score = 69.3 bits (168), Expect = 5e-10 Identities = 26/52 (50%), Positives = 38/52 (73%) Frame = -2 Query: 158 ALRRMSAGRALGPDGVPIEVWKIMGEVGLGWLTRLFNKIIATRRMPNEWRRS 3 A+++M AG+A GPDG+P+E W+ +GE+G+ WLT FN I + +MP WR S Sbjct: 501 AIKKMKAGKATGPDGIPVEAWRSLGELGVRWLTEFFNNITRSAKMPEAWRDS 552 >gb|EYC43100.1| hypothetical protein Y032_0503g2638 [Ancylostoma ceylanicum] Length = 982 Score = 69.3 bits (168), Expect = 5e-10 Identities = 26/52 (50%), Positives = 38/52 (73%) Frame = -2 Query: 158 ALRRMSAGRALGPDGVPIEVWKIMGEVGLGWLTRLFNKIIATRRMPNEWRRS 3 A+++M AG+A GPDG+P+E W+ +GE+G+ WLT FN I + +MP WR S Sbjct: 501 AIKKMKAGKATGPDGIPVEAWRSLGELGVRWLTEFFNNITRSAKMPEAWRDS 552 >gb|EYC40457.1| hypothetical protein Y032_0611g633 [Ancylostoma ceylanicum] Length = 982 Score = 69.3 bits (168), Expect = 5e-10 Identities = 26/52 (50%), Positives = 38/52 (73%) Frame = -2 Query: 158 ALRRMSAGRALGPDGVPIEVWKIMGEVGLGWLTRLFNKIIATRRMPNEWRRS 3 A+++M AG+A GPDG+P+E W+ +GE+G+ WLT FN I + +MP WR S Sbjct: 501 AIKKMKAGKATGPDGIPVEAWRSLGELGVRWLTEFFNNITRSAKMPEAWRDS 552 >gb|EYC39011.1| hypothetical protein Y032_0681g1482 [Ancylostoma ceylanicum] Length = 923 Score = 69.3 bits (168), Expect = 5e-10 Identities = 27/51 (52%), Positives = 38/51 (74%) Frame = -2 Query: 155 LRRMSAGRALGPDGVPIEVWKIMGEVGLGWLTRLFNKIIATRRMPNEWRRS 3 +++M G+A+GPDGVP+E WK++GE GL WLT FN I + R+P+ WR S Sbjct: 445 MKKMKIGKAVGPDGVPVEAWKVLGESGLLWLTTFFNNITRSERIPDAWRDS 495 >gb|EYC36392.1| hypothetical protein Y032_0900g2943 [Ancylostoma ceylanicum] Length = 726 Score = 69.3 bits (168), Expect = 5e-10 Identities = 26/52 (50%), Positives = 38/52 (73%) Frame = -2 Query: 158 ALRRMSAGRALGPDGVPIEVWKIMGEVGLGWLTRLFNKIIATRRMPNEWRRS 3 A+++M AG+A GPDG+P+E W+ +GE+G+ WLT FN I + +MP WR S Sbjct: 501 AIKKMKAGKATGPDGIPVEAWRSLGELGVRWLTEFFNNITRSAKMPEAWRDS 552