BLASTX nr result
ID: Paeonia24_contig00009848
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00009848 (289 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB93317.1| Calcium-dependent protein kinase 8 [Morus notabilis] 62 8e-08 ref|NP_001266123.1| calcium-dependent protein kinase 32-like [Ci... 62 8e-08 gb|AEY55359.1| calcium-dependent protein kinase [Morus alba var.... 62 8e-08 ref|XP_002322709.1| calcium-dependent protein kinase [Populus tr... 62 1e-07 gb|AEL88279.1| calcium-dependent protein kinase [Dimocarpus longan] 61 1e-07 emb|CAG27839.1| calcium-dependent protein kinase 8 [Nicotiana pl... 61 1e-07 gb|EPS73534.1| calcium-dependent protein kinase 8, partial [Genl... 60 2e-07 ref|XP_006366539.1| PREDICTED: calcium-dependent protein kinase ... 60 3e-07 ref|XP_004154632.1| PREDICTED: LOW QUALITY PROTEIN: calcium-depe... 60 3e-07 ref|XP_004139037.1| PREDICTED: calcium-dependent protein kinase ... 60 3e-07 gb|ACX37460.1| calcium dependent protein kinase 32 [Gossypium hi... 60 3e-07 gb|AHN16203.1| CPK8-2.1 [Brassica napus] 60 4e-07 gb|AGG35977.1| calcium-dependent protein kinase 8, partial [Bras... 60 4e-07 gb|AGG35976.1| calcium-dependent protein kinase 7 [Brassica napus] 60 4e-07 ref|XP_006399766.1| hypothetical protein EUTSA_v10013170mg [Eutr... 60 4e-07 ref|XP_007015067.1| Calcium-dependent protein kinase 19 isoform ... 60 4e-07 ref|XP_006289217.1| hypothetical protein CARUB_v10002666mg [Caps... 60 4e-07 ref|XP_004291780.1| PREDICTED: calcium-dependent protein kinase ... 60 4e-07 ref|XP_007211733.1| hypothetical protein PRUPE_ppa006164mg [Prun... 60 4e-07 gb|AFV29350.1| calcium-dependent protein kinase-like protein, pa... 60 4e-07 >gb|EXB93317.1| Calcium-dependent protein kinase 8 [Morus notabilis] Length = 579 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -1 Query: 289 TDWRKASRQYSRERFNNLSMELMRDGSLQLTTK 191 TDWRKASRQYSRERFN+LS++LMRDGSLQLT + Sbjct: 498 TDWRKASRQYSRERFNSLSLKLMRDGSLQLTNE 530 >ref|NP_001266123.1| calcium-dependent protein kinase 32-like [Cicer arietinum] gi|59709749|gb|AAP72282.2| calcium-dependent calmodulin-independent protein kinase isoform 2 [Cicer arietinum] Length = 540 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -1 Query: 289 TDWRKASRQYSRERFNNLSMELMRDGSLQLTTK 191 TDWRKASRQYSRERFN+LS++LMRDGSLQLT + Sbjct: 504 TDWRKASRQYSRERFNSLSLKLMRDGSLQLTNE 536 >gb|AEY55359.1| calcium-dependent protein kinase [Morus alba var. multicaulis] Length = 532 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -1 Query: 289 TDWRKASRQYSRERFNNLSMELMRDGSLQLTTK 191 TDWRKASRQYSRERFN+LS++LMRDGSLQLT + Sbjct: 498 TDWRKASRQYSRERFNSLSLKLMRDGSLQLTNE 530 >ref|XP_002322709.1| calcium-dependent protein kinase [Populus trichocarpa] gi|222867339|gb|EEF04470.1| calcium-dependent protein kinase [Populus trichocarpa] Length = 532 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/33 (81%), Positives = 33/33 (100%) Frame = -1 Query: 289 TDWRKASRQYSRERFNNLSMELMRDGSLQLTTK 191 TDWRKASRQYSRERFNNLS++LM+DGSL+LT++ Sbjct: 498 TDWRKASRQYSRERFNNLSLKLMKDGSLKLTSE 530 >gb|AEL88279.1| calcium-dependent protein kinase [Dimocarpus longan] Length = 534 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -1 Query: 289 TDWRKASRQYSRERFNNLSMELMRDGSLQLTTK 191 TDWRKASRQYSRERFNNLS++LMRDGSLQ+ + Sbjct: 500 TDWRKASRQYSRERFNNLSLKLMRDGSLQMNNE 532 >emb|CAG27839.1| calcium-dependent protein kinase 8 [Nicotiana plumbaginifolia] Length = 528 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -1 Query: 289 TDWRKASRQYSRERFNNLSMELMRDGSLQLTTK 191 TDWRKASRQYSRERFN+LS++LMRDGSLQL K Sbjct: 495 TDWRKASRQYSRERFNSLSLKLMRDGSLQLENK 527 >gb|EPS73534.1| calcium-dependent protein kinase 8, partial [Genlisea aurea] Length = 533 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -1 Query: 289 TDWRKASRQYSRERFNNLSMELMRDGSLQLTTK 191 TDWRKASRQYSRERFN+LS++LMR+GSLQLT + Sbjct: 501 TDWRKASRQYSRERFNSLSLKLMREGSLQLTNE 533 >ref|XP_006366539.1| PREDICTED: calcium-dependent protein kinase 8-like [Solanum tuberosum] Length = 533 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -1 Query: 289 TDWRKASRQYSRERFNNLSMELMRDGSLQLTTK 191 TDWRKASRQYSRERFN+LS++LMRDGSLQ+ K Sbjct: 500 TDWRKASRQYSRERFNSLSLKLMRDGSLQVENK 532 >ref|XP_004154632.1| PREDICTED: LOW QUALITY PROTEIN: calcium-dependent protein kinase 8-like [Cucumis sativus] Length = 530 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -1 Query: 289 TDWRKASRQYSRERFNNLSMELMRDGSLQLTTK 191 TDWRKASRQYSRERFN+LS++LMRDGSL LT + Sbjct: 496 TDWRKASRQYSRERFNSLSLKLMRDGSLHLTNE 528 >ref|XP_004139037.1| PREDICTED: calcium-dependent protein kinase 8-like [Cucumis sativus] Length = 531 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -1 Query: 289 TDWRKASRQYSRERFNNLSMELMRDGSLQLTTK 191 TDWRKASRQYSRERFN+LS++LMRDGSL LT + Sbjct: 497 TDWRKASRQYSRERFNSLSLKLMRDGSLHLTNE 529 >gb|ACX37460.1| calcium dependent protein kinase 32 [Gossypium hirsutum] Length = 550 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -1 Query: 289 TDWRKASRQYSRERFNNLSMELMRDGSLQLTTK 191 TDWRKASRQYSRERFNNLS++LM+DGSLQ+ + Sbjct: 501 TDWRKASRQYSRERFNNLSLKLMKDGSLQMNNE 533 >gb|AHN16203.1| CPK8-2.1 [Brassica napus] Length = 534 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -1 Query: 289 TDWRKASRQYSRERFNNLSMELMRDGSLQL 200 TDWRKASRQYSRERFN+LS++LMRDGSLQL Sbjct: 501 TDWRKASRQYSRERFNSLSLKLMRDGSLQL 530 >gb|AGG35977.1| calcium-dependent protein kinase 8, partial [Brassica napus] Length = 534 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -1 Query: 289 TDWRKASRQYSRERFNNLSMELMRDGSLQL 200 TDWRKASRQYSRERFN+LS++LMRDGSLQL Sbjct: 501 TDWRKASRQYSRERFNSLSLKLMRDGSLQL 530 >gb|AGG35976.1| calcium-dependent protein kinase 7 [Brassica napus] Length = 532 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -1 Query: 289 TDWRKASRQYSRERFNNLSMELMRDGSLQL 200 TDWRKASRQYSRERFN+LS++LMRDGSLQL Sbjct: 499 TDWRKASRQYSRERFNSLSLKLMRDGSLQL 528 >ref|XP_006399766.1| hypothetical protein EUTSA_v10013170mg [Eutrema salsugineum] gi|567173219|ref|XP_006399767.1| hypothetical protein EUTSA_v10013170mg [Eutrema salsugineum] gi|557100856|gb|ESQ41219.1| hypothetical protein EUTSA_v10013170mg [Eutrema salsugineum] gi|557100857|gb|ESQ41220.1| hypothetical protein EUTSA_v10013170mg [Eutrema salsugineum] Length = 548 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -1 Query: 289 TDWRKASRQYSRERFNNLSMELMRDGSLQL 200 TDWRKASRQYSRERFN+LS++LMRDGSLQL Sbjct: 515 TDWRKASRQYSRERFNSLSLKLMRDGSLQL 544 >ref|XP_007015067.1| Calcium-dependent protein kinase 19 isoform 1 [Theobroma cacao] gi|508785430|gb|EOY32686.1| Calcium-dependent protein kinase 19 isoform 1 [Theobroma cacao] Length = 532 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -1 Query: 289 TDWRKASRQYSRERFNNLSMELMRDGSLQL 200 TDWRKASRQYSRERFN+LS++LMRDGSLQL Sbjct: 501 TDWRKASRQYSRERFNSLSLKLMRDGSLQL 530 >ref|XP_006289217.1| hypothetical protein CARUB_v10002666mg [Capsella rubella] gi|482557923|gb|EOA22115.1| hypothetical protein CARUB_v10002666mg [Capsella rubella] Length = 534 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -1 Query: 289 TDWRKASRQYSRERFNNLSMELMRDGSLQL 200 TDWRKASRQYSRERFN+LS++LMRDGSLQL Sbjct: 501 TDWRKASRQYSRERFNSLSLKLMRDGSLQL 530 >ref|XP_004291780.1| PREDICTED: calcium-dependent protein kinase 8-like [Fragaria vesca subsp. vesca] Length = 532 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -1 Query: 289 TDWRKASRQYSRERFNNLSMELMRDGSLQLTTK 191 TDWRKASRQYSRERFN++S++LMR+GSLQLT + Sbjct: 498 TDWRKASRQYSRERFNSISLKLMREGSLQLTNE 530 >ref|XP_007211733.1| hypothetical protein PRUPE_ppa006164mg [Prunus persica] gi|462407598|gb|EMJ12932.1| hypothetical protein PRUPE_ppa006164mg [Prunus persica] Length = 425 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -1 Query: 289 TDWRKASRQYSRERFNNLSMELMRDGSLQLTTK 191 TDWRKASRQYSRERFN++S++LMR+GSLQL T+ Sbjct: 391 TDWRKASRQYSRERFNSISLKLMREGSLQLATE 423 >gb|AFV29350.1| calcium-dependent protein kinase-like protein, partial [Senecio vulgaris] Length = 145 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -1 Query: 289 TDWRKASRQYSRERFNNLSMELMRDGSLQLTTK 191 TDWRKASRQYSRERFNNLS++LM+DGSL+L + Sbjct: 111 TDWRKASRQYSRERFNNLSLKLMKDGSLELVNE 143