BLASTX nr result
ID: Paeonia24_contig00007330
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00007330 (472 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN63320.1| hypothetical protein VITISV_026425 [Vitis vinifera] 65 1e-08 ref|XP_003631786.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-08 >emb|CAN63320.1| hypothetical protein VITISV_026425 [Vitis vinifera] Length = 722 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = +2 Query: 2 GKAWNIVSLLKDMVIYGCEPNLATFNILNRAMSKDWMKRFPDV 130 GK W+IVSLLKDM + GCEPN + IL +AMSK WMKRFP+V Sbjct: 657 GKFWDIVSLLKDMTMDGCEPNAVSIEILKQAMSKCWMKRFPEV 699 >ref|XP_003631786.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, mitochondrial-like [Vitis vinifera] Length = 629 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = +2 Query: 2 GKAWNIVSLLKDMVIYGCEPNLATFNILNRAMSKDWMKRFPD 127 GK W+IVSLLKDM + GCEPN + IL +AMSK WMKRFP+ Sbjct: 549 GKFWDIVSLLKDMTMDGCEPNAVSIEILKQAMSKCWMKRFPE 590