BLASTX nr result
ID: Paeonia24_contig00006703
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00006703 (392 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006401881.1| hypothetical protein EUTSA_v10013582mg [Eutr... 96 5e-18 ref|NP_194274.2| zinc finger WD40 repeat protein 1 [Arabidopsis ... 96 7e-18 ref|XP_003570098.1| PREDICTED: zinc finger CCCH domain-containin... 96 7e-18 ref|XP_002867609.1| hypothetical protein ARALYDRAFT_329122 [Arab... 96 7e-18 emb|CAA18182.1| putative protein [Arabidopsis thaliana] 96 7e-18 ref|XP_006279619.1| hypothetical protein CARUB_v10026411mg [Caps... 95 1e-17 ref|XP_006413303.1| hypothetical protein EUTSA_v10025269mg [Eutr... 94 2e-17 ref|XP_006283770.1| hypothetical protein CARUB_v10004856mg [Caps... 94 3e-17 ref|XP_003548225.1| PREDICTED: zinc finger CCCH domain-containin... 93 3e-17 dbj|BAJ90661.1| predicted protein [Hordeum vulgare subsp. vulgare] 93 3e-17 ref|XP_002865885.1| hypothetical protein ARALYDRAFT_495266 [Arab... 93 3e-17 ref|XP_002280396.1| PREDICTED: zinc finger CCCH domain-containin... 92 6e-17 ref|NP_001032059.1| transducin/WD40 repeat-like superfamily prot... 92 7e-17 ref|NP_200011.1| transducin/WD40 repeat-like superfamily protein... 92 7e-17 gb|EEE57568.1| hypothetical protein OsJ_07917 [Oryza sativa Japo... 92 7e-17 gb|EEC73779.1| hypothetical protein OsI_08459 [Oryza sativa Indi... 92 7e-17 sp|Q0DYP5.2|C3H17_ORYSJ RecName: Full=Zinc finger CCCH domain-co... 92 7e-17 gb|EYU25047.1| hypothetical protein MIMGU_mgv1a006714mg [Mimulus... 92 1e-16 ref|XP_002321881.2| hypothetical protein POPTR_0015s13760g [Popu... 92 1e-16 ref|XP_002510854.1| F-box and wd40 domain protein, putative [Ric... 91 1e-16 >ref|XP_006401881.1| hypothetical protein EUTSA_v10013582mg [Eutrema salsugineum] gi|557102971|gb|ESQ43334.1| hypothetical protein EUTSA_v10013582mg [Eutrema salsugineum] Length = 436 Score = 95.9 bits (237), Expect = 5e-18 Identities = 43/70 (61%), Positives = 57/70 (81%), Gaps = 1/70 (1%) Frame = +3 Query: 108 SVRVWDLNKLECIQKLEGHTSPVTSVICWDGFLLSCSLDNTIKVWGIATEGGKIELMYTH 287 +++VW L+ L+CIQ L HTS V S+ICWD FLLSCSLDNT+K+W ATEGG +E+ YTH Sbjct: 294 TIKVWSLDNLQCIQTLTDHTSVVMSLICWDQFLLSCSLDNTVKIWA-ATEGGNLEVTYTH 352 Query: 288 QEKNGLL-LC 314 +E++G+L LC Sbjct: 353 KEEHGVLALC 362 >ref|NP_194274.2| zinc finger WD40 repeat protein 1 [Arabidopsis thaliana] gi|75334157|sp|Q9FNZ2.1|C3H48_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 48; Short=AtC3H48; AltName: Full=Zinc finger CCCH domain and WD40 repeat-containing protein 1 gi|12057164|emb|CAC19847.1| zfwd1 protein [Arabidopsis thaliana] gi|109946599|gb|ABG48478.1| At4g25440 [Arabidopsis thaliana] gi|332659660|gb|AEE85060.1| zinc finger WD40 repeat protein 1 [Arabidopsis thaliana] Length = 430 Score = 95.5 bits (236), Expect = 7e-18 Identities = 44/70 (62%), Positives = 56/70 (80%), Gaps = 1/70 (1%) Frame = +3 Query: 108 SVRVWDLNKLECIQKLEGHTSPVTSVICWDGFLLSCSLDNTIKVWGIATEGGKIELMYTH 287 S++VW L+ L+CIQ L HTS V S+ICWD FLLSCSLDNT+K+W ATEGG +E+ YTH Sbjct: 288 SIKVWSLDNLQCIQTLTEHTSVVMSLICWDQFLLSCSLDNTVKIWA-ATEGGNLEVTYTH 346 Query: 288 QEKNGLL-LC 314 +E+ G+L LC Sbjct: 347 KEEYGVLALC 356 >ref|XP_003570098.1| PREDICTED: zinc finger CCCH domain-containing protein 17-like [Brachypodium distachyon] Length = 432 Score = 95.5 bits (236), Expect = 7e-18 Identities = 44/67 (65%), Positives = 52/67 (77%) Frame = +3 Query: 108 SVRVWDLNKLECIQKLEGHTSPVTSVICWDGFLLSCSLDNTIKVWGIATEGGKIELMYTH 287 ++RVWDL L+CIQ L HTS V SV+CWD FLLSCSLD TIKVW ATE G +E+ YTH Sbjct: 292 TIRVWDLATLQCIQTLSDHTSVVMSVLCWDQFLLSCSLDQTIKVWA-ATESGNLEVTYTH 350 Query: 288 QEKNGLL 308 +E+NG L Sbjct: 351 KEENGAL 357 >ref|XP_002867609.1| hypothetical protein ARALYDRAFT_329122 [Arabidopsis lyrata subsp. lyrata] gi|297313445|gb|EFH43868.1| hypothetical protein ARALYDRAFT_329122 [Arabidopsis lyrata subsp. lyrata] Length = 667 Score = 95.5 bits (236), Expect = 7e-18 Identities = 44/70 (62%), Positives = 56/70 (80%), Gaps = 1/70 (1%) Frame = +3 Query: 108 SVRVWDLNKLECIQKLEGHTSPVTSVICWDGFLLSCSLDNTIKVWGIATEGGKIELMYTH 287 S++VW L+ L+CIQ L HTS V S+ICWD FLLSCSLDNT+K+W ATEGG +E+ YTH Sbjct: 286 SIKVWSLDNLQCIQTLTEHTSVVMSLICWDQFLLSCSLDNTVKIWA-ATEGGNLEVTYTH 344 Query: 288 QEKNGLL-LC 314 +E+ G+L LC Sbjct: 345 KEEYGVLALC 354 >emb|CAA18182.1| putative protein [Arabidopsis thaliana] Length = 668 Score = 95.5 bits (236), Expect = 7e-18 Identities = 44/70 (62%), Positives = 56/70 (80%), Gaps = 1/70 (1%) Frame = +3 Query: 108 SVRVWDLNKLECIQKLEGHTSPVTSVICWDGFLLSCSLDNTIKVWGIATEGGKIELMYTH 287 S++VW L+ L+CIQ L HTS V S+ICWD FLLSCSLDNT+K+W ATEGG +E+ YTH Sbjct: 288 SIKVWSLDNLQCIQTLTEHTSVVMSLICWDQFLLSCSLDNTVKIWA-ATEGGNLEVTYTH 346 Query: 288 QEKNGLL-LC 314 +E+ G+L LC Sbjct: 347 KEEYGVLALC 356 >ref|XP_006279619.1| hypothetical protein CARUB_v10026411mg [Capsella rubella] gi|482548323|gb|EOA12517.1| hypothetical protein CARUB_v10026411mg [Capsella rubella] Length = 441 Score = 94.7 bits (234), Expect = 1e-17 Identities = 43/70 (61%), Positives = 56/70 (80%), Gaps = 1/70 (1%) Frame = +3 Query: 108 SVRVWDLNKLECIQKLEGHTSPVTSVICWDGFLLSCSLDNTIKVWGIATEGGKIELMYTH 287 S++VW L+ L+CIQ L HTS V S+ICWD FLLSCSLDNT+K+W A EGG +E+ YTH Sbjct: 299 SIKVWSLDNLQCIQTLTDHTSVVMSLICWDQFLLSCSLDNTVKIWA-AMEGGNLEVTYTH 357 Query: 288 QEKNGLL-LC 314 +E++G+L LC Sbjct: 358 KEEHGVLALC 367 >ref|XP_006413303.1| hypothetical protein EUTSA_v10025269mg [Eutrema salsugineum] gi|557114473|gb|ESQ54756.1| hypothetical protein EUTSA_v10025269mg [Eutrema salsugineum] Length = 428 Score = 94.0 bits (232), Expect = 2e-17 Identities = 43/69 (62%), Positives = 55/69 (79%), Gaps = 1/69 (1%) Frame = +3 Query: 111 VRVWDLNKLECIQKLEGHTSPVTSVICWDGFLLSCSLDNTIKVWGIATEGGKIELMYTHQ 290 ++VW L+ L+CIQ L HTS V S+ICWD FLLSCSLDNT+K+W ATEGG +E+ YTH+ Sbjct: 287 IKVWSLDNLQCIQTLTEHTSVVMSLICWDQFLLSCSLDNTVKIWA-ATEGGNLEVTYTHK 345 Query: 291 EKNGLL-LC 314 E+ G+L LC Sbjct: 346 EEYGVLALC 354 >ref|XP_006283770.1| hypothetical protein CARUB_v10004856mg [Capsella rubella] gi|482552475|gb|EOA16668.1| hypothetical protein CARUB_v10004856mg [Capsella rubella] Length = 431 Score = 93.6 bits (231), Expect = 3e-17 Identities = 43/70 (61%), Positives = 55/70 (78%), Gaps = 1/70 (1%) Frame = +3 Query: 108 SVRVWDLNKLECIQKLEGHTSPVTSVICWDGFLLSCSLDNTIKVWGIATEGGKIELMYTH 287 S++VW L L+CIQ L HTS V S+ICW+ FLLSCSLDNT+K+W ATEGG +E+ YTH Sbjct: 289 SIKVWSLENLQCIQTLTEHTSVVMSLICWEQFLLSCSLDNTVKIWA-ATEGGNLEVTYTH 347 Query: 288 QEKNGLL-LC 314 +E+ G+L LC Sbjct: 348 KEEYGVLALC 357 >ref|XP_003548225.1| PREDICTED: zinc finger CCCH domain-containing protein 48-like [Glycine max] Length = 427 Score = 93.2 bits (230), Expect = 3e-17 Identities = 43/70 (61%), Positives = 54/70 (77%), Gaps = 1/70 (1%) Frame = +3 Query: 108 SVRVWDLNKLECIQKLEGHTSPVTSVICWDGFLLSCSLDNTIKVWGIATEGGKIELMYTH 287 ++RVW+L L+C+Q L HTS V SV+CWD FLLSCSLD T+KVW ATE G +E+ YTH Sbjct: 285 TIRVWNLETLQCLQTLTEHTSVVMSVLCWDQFLLSCSLDKTVKVW-YATESGNLEVTYTH 343 Query: 288 QEKNGLL-LC 314 E+NG+L LC Sbjct: 344 NEENGILTLC 353 >dbj|BAJ90661.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 433 Score = 93.2 bits (230), Expect = 3e-17 Identities = 42/67 (62%), Positives = 52/67 (77%) Frame = +3 Query: 108 SVRVWDLNKLECIQKLEGHTSPVTSVICWDGFLLSCSLDNTIKVWGIATEGGKIELMYTH 287 ++RVWDL L+CIQ L HT+ V S++CWD FLLSCSLD TIKVW ATE G +E+ YTH Sbjct: 293 TIRVWDLATLQCIQTLSDHTNVVMSLLCWDQFLLSCSLDQTIKVWA-ATESGNLEVTYTH 351 Query: 288 QEKNGLL 308 +E+NG L Sbjct: 352 KEENGAL 358 >ref|XP_002865885.1| hypothetical protein ARALYDRAFT_495266 [Arabidopsis lyrata subsp. lyrata] gi|297311720|gb|EFH42144.1| hypothetical protein ARALYDRAFT_495266 [Arabidopsis lyrata subsp. lyrata] Length = 440 Score = 93.2 bits (230), Expect = 3e-17 Identities = 42/70 (60%), Positives = 55/70 (78%), Gaps = 1/70 (1%) Frame = +3 Query: 108 SVRVWDLNKLECIQKLEGHTSPVTSVICWDGFLLSCSLDNTIKVWGIATEGGKIELMYTH 287 +++VW L+ L+CIQ L HTS V S+ICWD FLLSCSLDNT+K+W A EGG +E YTH Sbjct: 298 TIKVWSLDNLQCIQTLTDHTSVVMSLICWDQFLLSCSLDNTVKIWA-AVEGGNLEATYTH 356 Query: 288 QEKNGLL-LC 314 +E++G+L LC Sbjct: 357 KEEHGVLALC 366 >ref|XP_002280396.1| PREDICTED: zinc finger CCCH domain-containing protein 48 [Vitis vinifera] gi|297741123|emb|CBI31854.3| unnamed protein product [Vitis vinifera] Length = 442 Score = 92.4 bits (228), Expect = 6e-17 Identities = 42/70 (60%), Positives = 54/70 (77%), Gaps = 1/70 (1%) Frame = +3 Query: 108 SVRVWDLNKLECIQKLEGHTSPVTSVICWDGFLLSCSLDNTIKVWGIATEGGKIELMYTH 287 S+RVW+L L+C+Q L HTS V S++CWD FLLSCSLD T+KVW +ATE G +E+ YTH Sbjct: 301 SIRVWNLENLQCLQTLTEHTSVVMSLLCWDQFLLSCSLDGTVKVW-VATESGNLEVTYTH 359 Query: 288 QEKNGLL-LC 314 E+ G+L LC Sbjct: 360 NEEQGVLYLC 369 >ref|NP_001032059.1| transducin/WD40 repeat-like superfamily protein [Arabidopsis thaliana] gi|75334156|sp|Q9FNZ1.1|C3H63_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 63; Short=AtC3H63; AltName: Full=Zinc finger CCCH domain and WD40 repeat-containing protein 2 gi|12057166|emb|CAC19848.1| zfwd2 protein [Arabidopsis thaliana] gi|332008772|gb|AED96155.1| transducin/WD40 repeat-like superfamily protein [Arabidopsis thaliana] Length = 443 Score = 92.0 bits (227), Expect = 7e-17 Identities = 41/70 (58%), Positives = 56/70 (80%), Gaps = 1/70 (1%) Frame = +3 Query: 108 SVRVWDLNKLECIQKLEGHTSPVTSVICWDGFLLSCSLDNTIKVWGIATEGGKIELMYTH 287 +++VW L+ L+CIQ L H+S V S+ICWD FLLSCSLDNT+K+W A EGG +E+ YTH Sbjct: 295 TIKVWSLDNLQCIQTLTDHSSVVMSLICWDQFLLSCSLDNTVKIWA-AIEGGNLEVTYTH 353 Query: 288 QEKNGLL-LC 314 +E++G+L LC Sbjct: 354 KEEHGVLALC 363 >ref|NP_200011.1| transducin/WD40 repeat-like superfamily protein [Arabidopsis thaliana] gi|10177733|dbj|BAB11046.1| unnamed protein product [Arabidopsis thaliana] gi|332008771|gb|AED96154.1| transducin/WD40 repeat-like superfamily protein [Arabidopsis thaliana] Length = 437 Score = 92.0 bits (227), Expect = 7e-17 Identities = 41/70 (58%), Positives = 56/70 (80%), Gaps = 1/70 (1%) Frame = +3 Query: 108 SVRVWDLNKLECIQKLEGHTSPVTSVICWDGFLLSCSLDNTIKVWGIATEGGKIELMYTH 287 +++VW L+ L+CIQ L H+S V S+ICWD FLLSCSLDNT+K+W A EGG +E+ YTH Sbjct: 295 TIKVWSLDNLQCIQTLTDHSSVVMSLICWDQFLLSCSLDNTVKIWA-AIEGGNLEVTYTH 353 Query: 288 QEKNGLL-LC 314 +E++G+L LC Sbjct: 354 KEEHGVLALC 363 >gb|EEE57568.1| hypothetical protein OsJ_07917 [Oryza sativa Japonica Group] Length = 399 Score = 92.0 bits (227), Expect = 7e-17 Identities = 42/67 (62%), Positives = 51/67 (76%) Frame = +3 Query: 108 SVRVWDLNKLECIQKLEGHTSPVTSVICWDGFLLSCSLDNTIKVWGIATEGGKIELMYTH 287 ++RVWDL L+CIQ L HT V SV+CWD FLLSCSLD TIKVW ATE G +E+ YTH Sbjct: 258 TIRVWDLATLQCIQTLSDHTGVVMSVLCWDQFLLSCSLDQTIKVWA-ATESGSLEVTYTH 316 Query: 288 QEKNGLL 308 +E++G L Sbjct: 317 KEEHGAL 323 >gb|EEC73779.1| hypothetical protein OsI_08459 [Oryza sativa Indica Group] Length = 435 Score = 92.0 bits (227), Expect = 7e-17 Identities = 42/67 (62%), Positives = 51/67 (76%) Frame = +3 Query: 108 SVRVWDLNKLECIQKLEGHTSPVTSVICWDGFLLSCSLDNTIKVWGIATEGGKIELMYTH 287 ++RVWDL L+CIQ L HT V SV+CWD FLLSCSLD TIKVW ATE G +E+ YTH Sbjct: 294 TIRVWDLATLQCIQTLSDHTGVVMSVLCWDQFLLSCSLDQTIKVWA-ATESGSLEVTYTH 352 Query: 288 QEKNGLL 308 +E++G L Sbjct: 353 KEEHGAL 359 >sp|Q0DYP5.2|C3H17_ORYSJ RecName: Full=Zinc finger CCCH domain-containing protein 17; Short=OsC3H17 Length = 435 Score = 92.0 bits (227), Expect = 7e-17 Identities = 42/67 (62%), Positives = 51/67 (76%) Frame = +3 Query: 108 SVRVWDLNKLECIQKLEGHTSPVTSVICWDGFLLSCSLDNTIKVWGIATEGGKIELMYTH 287 ++RVWDL L+CIQ L HT V SV+CWD FLLSCSLD TIKVW ATE G +E+ YTH Sbjct: 294 TIRVWDLATLQCIQTLSDHTGVVMSVLCWDQFLLSCSLDQTIKVWA-ATESGSLEVTYTH 352 Query: 288 QEKNGLL 308 +E++G L Sbjct: 353 KEEHGAL 359 >gb|EYU25047.1| hypothetical protein MIMGU_mgv1a006714mg [Mimulus guttatus] Length = 434 Score = 91.7 bits (226), Expect = 1e-16 Identities = 42/70 (60%), Positives = 53/70 (75%), Gaps = 1/70 (1%) Frame = +3 Query: 108 SVRVWDLNKLECIQKLEGHTSPVTSVICWDGFLLSCSLDNTIKVWGIATEGGKIELMYTH 287 S+RVW+L L+C+Q L GHT V SV+CWD FLLS SLD T+K+W ATE G +E+ YTH Sbjct: 294 SIRVWNLESLQCLQTLSGHTDVVMSVLCWDQFLLSASLDKTVKIWA-ATESGNLEVTYTH 352 Query: 288 QEKNGLL-LC 314 E++GLL LC Sbjct: 353 TEEHGLLTLC 362 >ref|XP_002321881.2| hypothetical protein POPTR_0015s13760g [Populus trichocarpa] gi|550322663|gb|EEF06008.2| hypothetical protein POPTR_0015s13760g [Populus trichocarpa] Length = 454 Score = 91.7 bits (226), Expect = 1e-16 Identities = 42/70 (60%), Positives = 55/70 (78%), Gaps = 1/70 (1%) Frame = +3 Query: 108 SVRVWDLNKLECIQKLEGHTSPVTSVICWDGFLLSCSLDNTIKVWGIATEGGKIELMYTH 287 S++VW L L+C+Q L+ HTS V S++CW+ FLLSCSLD TIKVW ATE G +E+ YTH Sbjct: 313 SIKVWSLETLQCVQTLKDHTSVVMSLLCWEQFLLSCSLDQTIKVWA-ATESGNLEVTYTH 371 Query: 288 QEKNGLL-LC 314 +E++GLL LC Sbjct: 372 KEEHGLLTLC 381 >ref|XP_002510854.1| F-box and wd40 domain protein, putative [Ricinus communis] gi|223549969|gb|EEF51456.1| F-box and wd40 domain protein, putative [Ricinus communis] Length = 445 Score = 91.3 bits (225), Expect = 1e-16 Identities = 43/70 (61%), Positives = 53/70 (75%), Gaps = 1/70 (1%) Frame = +3 Query: 108 SVRVWDLNKLECIQKLEGHTSPVTSVICWDGFLLSCSLDNTIKVWGIATEGGKIELMYTH 287 S+RVW+L L+C+Q L HTS V SV+CWD FLLSCSLD IKVW ATE G +++ YTH Sbjct: 304 SIRVWNLETLQCVQTLTDHTSVVMSVLCWDQFLLSCSLDQKIKVWA-ATESGNLDVTYTH 362 Query: 288 QEKNGLL-LC 314 E++GLL LC Sbjct: 363 NEEHGLLTLC 372