BLASTX nr result
ID: Paeonia24_contig00006190
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00006190 (300 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002301051.1| hypothetical protein POPTR_0002s09670g [Popu... 47 1e-08 ref|XP_007018781.1| Retrotransposon-derived protein PEG10, putat... 40 8e-07 ref|XP_007226621.1| hypothetical protein PRUPE_ppa022895mg [Prun... 43 4e-06 >ref|XP_002301051.1| hypothetical protein POPTR_0002s09670g [Populus trichocarpa] gi|222842777|gb|EEE80324.1| hypothetical protein POPTR_0002s09670g [Populus trichocarpa] Length = 105 Score = 47.4 bits (111), Expect(2) = 1e-08 Identities = 20/28 (71%), Positives = 27/28 (96%) Frame = -2 Query: 107 VGDLKIELVRERMKSKRIEICGLVEVML 24 +GDLK+EL RER+KSKRI++CGL+EV+L Sbjct: 58 IGDLKMELARERLKSKRIKLCGLMEVIL 85 Score = 37.4 bits (85), Expect(2) = 1e-08 Identities = 20/34 (58%), Positives = 24/34 (70%), Gaps = 1/34 (2%) Frame = -1 Query: 273 MEGVES-ERNDEVLKSQVAIRCAKATLFI*SLKS 175 MEG E E D+ LKSQVA+RCAKA + + LKS Sbjct: 1 MEGAEKMESKDKPLKSQVAVRCAKAAILLSLLKS 34 >ref|XP_007018781.1| Retrotransposon-derived protein PEG10, putative [Theobroma cacao] gi|508724109|gb|EOY16006.1| Retrotransposon-derived protein PEG10, putative [Theobroma cacao] Length = 113 Score = 39.7 bits (91), Expect(2) = 8e-07 Identities = 21/42 (50%), Positives = 27/42 (64%) Frame = -1 Query: 273 MEGVESERNDEVLKSQVAIRCAKATLFI*SLKSVGSHTSRSA 148 MEG+E++ DE K +AIRCAKA L + SLKS S +A Sbjct: 1 MEGIEAKTRDEAPKLLMAIRCAKAALLLSSLKSSVSRVFEAA 42 Score = 38.9 bits (89), Expect(2) = 8e-07 Identities = 16/43 (37%), Positives = 30/43 (69%) Frame = -2 Query: 146 NSMKARKGDVDESVGDLKIELVRERMKSKRIEICGLVEVMLTL 18 N K + + +L++ELV+ER+K K+I++CG++E++L L Sbjct: 44 NDEDEEKEKMRREIENLRVELVKERLKIKKIKLCGVMELILQL 86 >ref|XP_007226621.1| hypothetical protein PRUPE_ppa022895mg [Prunus persica] gi|462423557|gb|EMJ27820.1| hypothetical protein PRUPE_ppa022895mg [Prunus persica] Length = 110 Score = 42.7 bits (99), Expect(2) = 4e-06 Identities = 17/30 (56%), Positives = 27/30 (90%) Frame = -2 Query: 107 VGDLKIELVRERMKSKRIEICGLVEVMLTL 18 +GDLK+E+ RER+ +KRI++CGL+E++L L Sbjct: 61 IGDLKMEVARERLLNKRIKLCGLLELLLQL 90 Score = 33.5 bits (75), Expect(2) = 4e-06 Identities = 19/36 (52%), Positives = 23/36 (63%), Gaps = 3/36 (8%) Frame = -1 Query: 273 MEGVESE---RNDEVLKSQVAIRCAKATLFI*SLKS 175 MEG E++ E L+S AIRCAKA L + SLKS Sbjct: 1 MEGRETQTKGEGGEALRSHAAIRCAKAALLLSSLKS 36