BLASTX nr result
ID: Paeonia24_contig00006179
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00006179 (588 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006428293.1| hypothetical protein CICLE_v10013618mg [Citr... 62 2e-07 ref|XP_007013917.1| Pleiotropic drug resistance 9 isoform 1 [The... 62 2e-07 ref|XP_006480377.1| PREDICTED: pleiotropic drug resistance prote... 61 2e-07 ref|XP_006480376.1| PREDICTED: pleiotropic drug resistance prote... 61 2e-07 ref|XP_006428294.1| hypothetical protein CICLE_v10010905mg [Citr... 61 2e-07 ref|XP_004298256.1| PREDICTED: pleiotropic drug resistance prote... 61 2e-07 ref|XP_007226413.1| hypothetical protein PRUPE_ppa023381mg [Prun... 61 2e-07 ref|XP_002519313.1| ATP-binding cassette transporter, putative [... 61 3e-07 ref|XP_002311359.2| hypothetical protein POPTR_0008s09840g [Popu... 60 6e-07 emb|CAB10301.1| ABC transporter homolog [Arabidopsis thaliana] g... 59 1e-06 emb|CBI39657.3| unnamed protein product [Vitis vinifera] 59 1e-06 ref|XP_002280231.1| PREDICTED: pleiotropic drug resistance prote... 59 1e-06 emb|CAN65735.1| hypothetical protein VITISV_037751 [Vitis vinifera] 59 1e-06 gb|EYU19393.1| hypothetical protein MIMGU_mgv1a000209mg [Mimulus... 59 1e-06 gb|EXB80290.1| Pleiotropic drug resistance protein 3 [Morus nota... 59 1e-06 ref|XP_006477851.1| PREDICTED: pleiotropic drug resistance prote... 59 1e-06 ref|XP_006442391.1| hypothetical protein CICLE_v10024261mg [Citr... 59 1e-06 ref|XP_007051254.1| Pleiotropic drug resistance 2, putative [The... 58 2e-06 ref|XP_004302337.1| PREDICTED: pleiotropic drug resistance prote... 58 2e-06 ref|XP_004230351.1| PREDICTED: pleiotropic drug resistance prote... 58 2e-06 >ref|XP_006428293.1| hypothetical protein CICLE_v10013618mg [Citrus clementina] gi|557530350|gb|ESR41533.1| hypothetical protein CICLE_v10013618mg [Citrus clementina] Length = 1430 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +3 Query: 33 RVGVKLPTVEVRYKNLCVDAECVVVHGKPLP 125 +VGVKLPT+EVRYKNLCV+A+C VVHGKPLP Sbjct: 128 KVGVKLPTIEVRYKNLCVEAKCEVVHGKPLP 158 >ref|XP_007013917.1| Pleiotropic drug resistance 9 isoform 1 [Theobroma cacao] gi|508784280|gb|EOY31536.1| Pleiotropic drug resistance 9 isoform 1 [Theobroma cacao] Length = 1396 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +3 Query: 27 LCRVGVKLPTVEVRYKNLCVDAECVVVHGKPLP 125 L RVGVKLPTVEVRY+NLCV+AEC V+HG+PLP Sbjct: 78 LDRVGVKLPTVEVRYRNLCVEAECDVIHGEPLP 110 >ref|XP_006480377.1| PREDICTED: pleiotropic drug resistance protein 3-like isoform X2 [Citrus sinensis] Length = 1446 Score = 61.2 bits (147), Expect = 2e-07 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = +3 Query: 33 RVGVKLPTVEVRYKNLCVDAECVVVHGKPLP 125 +VG+KLPT+EVRYKNLCV+A+C VVHGKPLP Sbjct: 128 KVGIKLPTIEVRYKNLCVEAKCEVVHGKPLP 158 >ref|XP_006480376.1| PREDICTED: pleiotropic drug resistance protein 3-like isoform X1 [Citrus sinensis] Length = 1449 Score = 61.2 bits (147), Expect = 2e-07 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = +3 Query: 33 RVGVKLPTVEVRYKNLCVDAECVVVHGKPLP 125 +VG+KLPT+EVRYKNLCV+A+C VVHGKPLP Sbjct: 128 KVGIKLPTIEVRYKNLCVEAKCEVVHGKPLP 158 >ref|XP_006428294.1| hypothetical protein CICLE_v10010905mg [Citrus clementina] gi|557530351|gb|ESR41534.1| hypothetical protein CICLE_v10010905mg [Citrus clementina] Length = 1449 Score = 61.2 bits (147), Expect = 2e-07 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = +3 Query: 33 RVGVKLPTVEVRYKNLCVDAECVVVHGKPLP 125 +VG+KLPT+EVRYKNLCV+A+C VVHGKPLP Sbjct: 128 KVGIKLPTIEVRYKNLCVEAKCEVVHGKPLP 158 >ref|XP_004298256.1| PREDICTED: pleiotropic drug resistance protein 3-like [Fragaria vesca subsp. vesca] Length = 1452 Score = 61.2 bits (147), Expect = 2e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +3 Query: 33 RVGVKLPTVEVRYKNLCVDAECVVVHGKPLP 125 +VGVK PTVEVRYKNLCV+A+C+VVHGKPLP Sbjct: 132 KVGVKSPTVEVRYKNLCVEADCMVVHGKPLP 162 >ref|XP_007226413.1| hypothetical protein PRUPE_ppa023381mg [Prunus persica] gi|462423349|gb|EMJ27612.1| hypothetical protein PRUPE_ppa023381mg [Prunus persica] Length = 1392 Score = 61.2 bits (147), Expect = 2e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 33 RVGVKLPTVEVRYKNLCVDAECVVVHGKPLP 125 +VGVKLP VEVRYKNLCV+AEC VVHGKPLP Sbjct: 131 KVGVKLPIVEVRYKNLCVEAECKVVHGKPLP 161 >ref|XP_002519313.1| ATP-binding cassette transporter, putative [Ricinus communis] gi|223541628|gb|EEF43177.1| ATP-binding cassette transporter, putative [Ricinus communis] Length = 1393 Score = 60.8 bits (146), Expect = 3e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +3 Query: 33 RVGVKLPTVEVRYKNLCVDAECVVVHGKPLP 125 RVGV+LPTVEVRY+NLCV+AEC VVHG+PLP Sbjct: 122 RVGVQLPTVEVRYRNLCVEAECKVVHGRPLP 152 >ref|XP_002311359.2| hypothetical protein POPTR_0008s09840g [Populus trichocarpa] gi|550332751|gb|EEE88726.2| hypothetical protein POPTR_0008s09840g [Populus trichocarpa] Length = 1476 Score = 59.7 bits (143), Expect = 6e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +3 Query: 33 RVGVKLPTVEVRYKNLCVDAECVVVHGKPLP 125 +VGVK PTVEVRY+NLCV+AEC +VHGKPLP Sbjct: 130 KVGVKFPTVEVRYRNLCVEAECELVHGKPLP 160 >emb|CAB10301.1| ABC transporter homolog [Arabidopsis thaliana] gi|7268268|emb|CAB78564.1| ABC transporter homolog [Arabidopsis thaliana] Length = 290 Score = 58.9 bits (141), Expect = 1e-06 Identities = 24/37 (64%), Positives = 31/37 (83%) Frame = +3 Query: 15 DPIVLCRVGVKLPTVEVRYKNLCVDAECVVVHGKPLP 125 +P CRVG++LPTVEVR+ NL V+AEC V+HGKP+P Sbjct: 117 EPSCNCRVGIELPTVEVRFNNLSVEAECQVIHGKPIP 153 >emb|CBI39657.3| unnamed protein product [Vitis vinifera] Length = 1406 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 33 RVGVKLPTVEVRYKNLCVDAECVVVHGKPLP 125 +VGVKLPTVEVRYKNL V+AEC VVHGKPLP Sbjct: 84 KVGVKLPTVEVRYKNLRVEAECEVVHGKPLP 114 >ref|XP_002280231.1| PREDICTED: pleiotropic drug resistance protein 3-like [Vitis vinifera] Length = 1448 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 33 RVGVKLPTVEVRYKNLCVDAECVVVHGKPLP 125 +VGVKLPTVEVRYKNL V+AEC VVHGKPLP Sbjct: 126 KVGVKLPTVEVRYKNLRVEAECEVVHGKPLP 156 >emb|CAN65735.1| hypothetical protein VITISV_037751 [Vitis vinifera] Length = 1417 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 33 RVGVKLPTVEVRYKNLCVDAECVVVHGKPLP 125 +VGVKLPTVEVRYKNL V+AEC VVHGKPLP Sbjct: 126 KVGVKLPTVEVRYKNLRVEAECEVVHGKPLP 156 >gb|EYU19393.1| hypothetical protein MIMGU_mgv1a000209mg [Mimulus guttatus] Length = 1430 Score = 58.5 bits (140), Expect = 1e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +3 Query: 33 RVGVKLPTVEVRYKNLCVDAECVVVHGKPLP 125 +VGVKLPT+EVRYKNL VDAEC VV+GKPLP Sbjct: 114 KVGVKLPTIEVRYKNLSVDAECEVVYGKPLP 144 >gb|EXB80290.1| Pleiotropic drug resistance protein 3 [Morus notabilis] Length = 1451 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +3 Query: 33 RVGVKLPTVEVRYKNLCVDAECVVVHGKPLP 125 RVGVKLPT+EVRY+NL V+AEC +VHGKPLP Sbjct: 131 RVGVKLPTIEVRYENLSVEAECKIVHGKPLP 161 >ref|XP_006477851.1| PREDICTED: pleiotropic drug resistance protein 3-like [Citrus sinensis] Length = 1440 Score = 58.5 bits (140), Expect = 1e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 33 RVGVKLPTVEVRYKNLCVDAECVVVHGKPLP 125 RVGV+LPTVEVRYKNL V+AEC VVHGKPLP Sbjct: 119 RVGVQLPTVEVRYKNLGVEAECEVVHGKPLP 149 >ref|XP_006442391.1| hypothetical protein CICLE_v10024261mg [Citrus clementina] gi|557544653|gb|ESR55631.1| hypothetical protein CICLE_v10024261mg [Citrus clementina] Length = 1395 Score = 58.5 bits (140), Expect = 1e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 33 RVGVKLPTVEVRYKNLCVDAECVVVHGKPLP 125 RVGV+LPTVEVRYKNL V+AEC VVHGKPLP Sbjct: 119 RVGVQLPTVEVRYKNLGVEAECEVVHGKPLP 149 >ref|XP_007051254.1| Pleiotropic drug resistance 2, putative [Theobroma cacao] gi|508703515|gb|EOX95411.1| Pleiotropic drug resistance 2, putative [Theobroma cacao] Length = 1403 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +3 Query: 36 VGVKLPTVEVRYKNLCVDAECVVVHGKPLP 125 VG+KLPT+EVRY+NLC +AEC VVHGKPLP Sbjct: 14 VGLKLPTIEVRYENLCAEAECEVVHGKPLP 43 >ref|XP_004302337.1| PREDICTED: pleiotropic drug resistance protein 3-like [Fragaria vesca subsp. vesca] Length = 1443 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 33 RVGVKLPTVEVRYKNLCVDAECVVVHGKPLP 125 RVGVKLPTVEVRYKNL V+A C VVHGKPLP Sbjct: 128 RVGVKLPTVEVRYKNLSVEAVCEVVHGKPLP 158 >ref|XP_004230351.1| PREDICTED: pleiotropic drug resistance protein 3-like isoform 2 [Solanum lycopersicum] Length = 1172 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +3 Query: 33 RVGVKLPTVEVRYKNLCVDAECVVVHGKPLP 125 +VGVKLPTVEVRYKNL ++AEC +VHGKPLP Sbjct: 129 KVGVKLPTVEVRYKNLTIEAECELVHGKPLP 159