BLASTX nr result
ID: Paeonia24_contig00005884
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00005884 (332 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282374.1| PREDICTED: uncharacterized protein At2g39795... 58 1e-06 ref|XP_007009205.1| Mitochondrial glycoprotein family protein, p... 57 2e-06 ref|XP_007009204.1| Mitochondrial glycoprotein family protein, p... 57 2e-06 >ref|XP_002282374.1| PREDICTED: uncharacterized protein At2g39795, mitochondrial [Vitis vinifera] gi|296086172|emb|CBI31613.3| unnamed protein product [Vitis vinifera] Length = 253 Score = 58.2 bits (139), Expect = 1e-06 Identities = 33/60 (55%), Positives = 40/60 (66%) Frame = -3 Query: 195 MALATIIRRSASSVAPLAIRFVQTQRQHQAAIFTALYHTTLSRKTSSSPFYLHALNYSSS 16 MA+ TI+RRS SSV PLA+R VQ + H +A+FTALYH +L K S PF YSSS Sbjct: 1 MAVTTILRRSISSVMPLAVRVVQ-RNHHHSALFTALYHGSLFHKPSLRPFASTLHFYSSS 59 >ref|XP_007009205.1| Mitochondrial glycoprotein family protein, putative isoform 2, partial [Theobroma cacao] gi|508726118|gb|EOY18015.1| Mitochondrial glycoprotein family protein, putative isoform 2, partial [Theobroma cacao] Length = 254 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/65 (43%), Positives = 47/65 (72%) Frame = -3 Query: 195 MALATIIRRSASSVAPLAIRFVQTQRQHQAAIFTALYHTTLSRKTSSSPFYLHALNYSSS 16 MALA+I+R+SA+S+APLAIR + QR + + +FTAL H+ S+K+ + F + L++S++ Sbjct: 1 MALASIVRKSANSLAPLAIRLTRVQRNYHSCVFTALNHSFQSQKSGVNRFCPNILHFSTA 60 Query: 15 PAVKR 1 K+ Sbjct: 61 VDSKK 65 >ref|XP_007009204.1| Mitochondrial glycoprotein family protein, putative isoform 1 [Theobroma cacao] gi|508726117|gb|EOY18014.1| Mitochondrial glycoprotein family protein, putative isoform 1 [Theobroma cacao] Length = 258 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/65 (43%), Positives = 47/65 (72%) Frame = -3 Query: 195 MALATIIRRSASSVAPLAIRFVQTQRQHQAAIFTALYHTTLSRKTSSSPFYLHALNYSSS 16 MALA+I+R+SA+S+APLAIR + QR + + +FTAL H+ S+K+ + F + L++S++ Sbjct: 1 MALASIVRKSANSLAPLAIRLTRVQRNYHSCVFTALNHSFQSQKSGVNRFCPNILHFSTA 60 Query: 15 PAVKR 1 K+ Sbjct: 61 VDSKK 65