BLASTX nr result
ID: Paeonia24_contig00004682
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00004682 (263 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006425525.1| hypothetical protein CICLE_v10026741mg [Citr... 105 9e-21 gb|AHW49188.1| histone H3, partial [Juglans sigillata] 103 2e-20 gb|EYU30980.1| hypothetical protein MIMGU_mgv1a014700mg [Mimulus... 103 2e-20 gb|EXC09698.1| Histone [Morus notabilis] 103 2e-20 ref|XP_003552025.2| PREDICTED: histone H3.3-like [Glycine max] 103 2e-20 ref|XP_007163668.1| hypothetical protein PHAVU_001G253800g [Phas... 103 2e-20 ref|XP_006411806.1| hypothetical protein EUTSA_v10026962mg [Eutr... 103 2e-20 ref|XP_006386413.1| hypothetical protein POPTR_0002s10030g [Popu... 103 2e-20 ref|XP_006851804.1| hypothetical protein AMTR_s00041p00020660 [A... 103 2e-20 dbj|BAN42603.1| putative histone H3, partial [Pyrus pyrifolia va... 103 2e-20 ref|XP_006288773.1| hypothetical protein CARUB_v10002094mg, part... 103 2e-20 gb|EMT02210.1| Histone H3.3 [Aegilops tauschii] 103 2e-20 gb|EMS66058.1| Histone H3.3 [Triticum urartu] 103 2e-20 gb|EMS58978.1| Histone H3.3 [Triticum urartu] gi|475497358|gb|EM... 103 2e-20 gb|EMS58296.1| Histone H3.3 [Triticum urartu] 103 2e-20 gb|AAB03542.1| histone H3, partial [Triticum aestivum] 103 2e-20 gb|AAB03538.1| histone H3, partial [Glycine max] gi|1053049|gb|A... 103 2e-20 gb|AAF87128.1|AC006434_24 F10A5.19 [Arabidopsis thaliana] 103 2e-20 gb|AAB03537.1| histone H3, partial [Glycine max] 103 2e-20 gb|AAX92698.1| histone 3 [Picea abies] 103 2e-20 >ref|XP_006425525.1| hypothetical protein CICLE_v10026741mg [Citrus clementina] gi|568825090|ref|XP_006466922.1| PREDICTED: histone H3.3-like [Citrus sinensis] gi|590702900|ref|XP_007046734.1| Histone superfamily protein [Theobroma cacao] gi|508698995|gb|EOX90891.1| Histone superfamily protein [Theobroma cacao] gi|557527515|gb|ESR38765.1| hypothetical protein CICLE_v10026741mg [Citrus clementina] Length = 136 Score = 105 bits (261), Expect = 9e-21 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = -3 Query: 261 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAR 106 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAR Sbjct: 65 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAR 116 >gb|AHW49188.1| histone H3, partial [Juglans sigillata] Length = 75 Score = 103 bits (258), Expect = 2e-20 Identities = 51/52 (98%), Positives = 52/52 (100%) Frame = -3 Query: 261 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAR 106 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA+ Sbjct: 4 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK 55 >gb|EYU30980.1| hypothetical protein MIMGU_mgv1a014700mg [Mimulus guttatus] Length = 181 Score = 103 bits (258), Expect = 2e-20 Identities = 51/52 (98%), Positives = 52/52 (100%) Frame = -3 Query: 261 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAR 106 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA+ Sbjct: 110 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK 161 >gb|EXC09698.1| Histone [Morus notabilis] Length = 159 Score = 103 bits (258), Expect = 2e-20 Identities = 51/52 (98%), Positives = 52/52 (100%) Frame = -3 Query: 261 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAR 106 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA+ Sbjct: 88 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK 139 >ref|XP_003552025.2| PREDICTED: histone H3.3-like [Glycine max] Length = 186 Score = 103 bits (258), Expect = 2e-20 Identities = 51/52 (98%), Positives = 52/52 (100%) Frame = -3 Query: 261 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAR 106 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA+ Sbjct: 115 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK 166 >ref|XP_007163668.1| hypothetical protein PHAVU_001G253800g [Phaseolus vulgaris] gi|561037132|gb|ESW35662.1| hypothetical protein PHAVU_001G253800g [Phaseolus vulgaris] Length = 202 Score = 103 bits (258), Expect = 2e-20 Identities = 51/52 (98%), Positives = 52/52 (100%) Frame = -3 Query: 261 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAR 106 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA+ Sbjct: 131 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK 182 >ref|XP_006411806.1| hypothetical protein EUTSA_v10026962mg [Eutrema salsugineum] gi|557112976|gb|ESQ53259.1| hypothetical protein EUTSA_v10026962mg [Eutrema salsugineum] Length = 125 Score = 103 bits (258), Expect = 2e-20 Identities = 51/52 (98%), Positives = 52/52 (100%) Frame = -3 Query: 261 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAR 106 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA+ Sbjct: 54 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK 105 >ref|XP_006386413.1| hypothetical protein POPTR_0002s10030g [Populus trichocarpa] gi|550344676|gb|ERP64210.1| hypothetical protein POPTR_0002s10030g [Populus trichocarpa] Length = 192 Score = 103 bits (258), Expect = 2e-20 Identities = 51/52 (98%), Positives = 52/52 (100%) Frame = -3 Query: 261 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAR 106 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA+ Sbjct: 65 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK 116 >ref|XP_006851804.1| hypothetical protein AMTR_s00041p00020660 [Amborella trichopoda] gi|548855387|gb|ERN13271.1| hypothetical protein AMTR_s00041p00020660 [Amborella trichopoda] Length = 136 Score = 103 bits (258), Expect = 2e-20 Identities = 51/52 (98%), Positives = 52/52 (100%) Frame = -3 Query: 261 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAR 106 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA+ Sbjct: 65 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK 116 >dbj|BAN42603.1| putative histone H3, partial [Pyrus pyrifolia var. culta] gi|511093976|dbj|BAN42604.1| putative histone H3, partial [Pyrus pyrifolia var. culta] Length = 86 Score = 103 bits (258), Expect = 2e-20 Identities = 51/52 (98%), Positives = 52/52 (100%) Frame = -3 Query: 261 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAR 106 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA+ Sbjct: 15 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK 66 >ref|XP_006288773.1| hypothetical protein CARUB_v10002094mg, partial [Capsella rubella] gi|482557479|gb|EOA21671.1| hypothetical protein CARUB_v10002094mg, partial [Capsella rubella] Length = 175 Score = 103 bits (258), Expect = 2e-20 Identities = 51/52 (98%), Positives = 52/52 (100%) Frame = -3 Query: 261 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAR 106 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA+ Sbjct: 104 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK 155 >gb|EMT02210.1| Histone H3.3 [Aegilops tauschii] Length = 150 Score = 103 bits (258), Expect = 2e-20 Identities = 51/52 (98%), Positives = 52/52 (100%) Frame = -3 Query: 261 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAR 106 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA+ Sbjct: 79 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK 130 >gb|EMS66058.1| Histone H3.3 [Triticum urartu] Length = 94 Score = 103 bits (258), Expect = 2e-20 Identities = 51/52 (98%), Positives = 52/52 (100%) Frame = -3 Query: 261 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAR 106 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA+ Sbjct: 23 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK 74 >gb|EMS58978.1| Histone H3.3 [Triticum urartu] gi|475497358|gb|EMT03998.1| Histone H3.3 [Aegilops tauschii] gi|475497359|gb|EMT03999.1| Histone H3.3 [Aegilops tauschii] Length = 137 Score = 103 bits (258), Expect = 2e-20 Identities = 51/52 (98%), Positives = 52/52 (100%) Frame = -3 Query: 261 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAR 106 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA+ Sbjct: 66 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK 117 >gb|EMS58296.1| Histone H3.3 [Triticum urartu] Length = 124 Score = 103 bits (258), Expect = 2e-20 Identities = 51/52 (98%), Positives = 52/52 (100%) Frame = -3 Query: 261 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAR 106 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA+ Sbjct: 53 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK 104 >gb|AAB03542.1| histone H3, partial [Triticum aestivum] Length = 127 Score = 103 bits (258), Expect = 2e-20 Identities = 51/52 (98%), Positives = 52/52 (100%) Frame = -3 Query: 261 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAR 106 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA+ Sbjct: 65 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK 116 >gb|AAB03538.1| histone H3, partial [Glycine max] gi|1053049|gb|AAB03539.1| histone H3, partial [Glycine max] gi|1053051|gb|AAB03540.1| histone H3, partial [Glycine max] Length = 127 Score = 103 bits (258), Expect = 2e-20 Identities = 51/52 (98%), Positives = 52/52 (100%) Frame = -3 Query: 261 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAR 106 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA+ Sbjct: 65 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK 116 >gb|AAF87128.1|AC006434_24 F10A5.19 [Arabidopsis thaliana] Length = 236 Score = 103 bits (258), Expect = 2e-20 Identities = 51/52 (98%), Positives = 52/52 (100%) Frame = -3 Query: 261 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAR 106 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA+ Sbjct: 165 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK 216 Score = 102 bits (255), Expect = 4e-20 Identities = 50/52 (96%), Positives = 52/52 (100%) Frame = -3 Query: 261 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAR 106 KLPFQRLVREIAQD+KTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA+ Sbjct: 65 KLPFQRLVREIAQDYKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK 116 >gb|AAB03537.1| histone H3, partial [Glycine max] Length = 127 Score = 103 bits (258), Expect = 2e-20 Identities = 51/52 (98%), Positives = 52/52 (100%) Frame = -3 Query: 261 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAR 106 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA+ Sbjct: 65 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK 116 >gb|AAX92698.1| histone 3 [Picea abies] Length = 136 Score = 103 bits (258), Expect = 2e-20 Identities = 51/52 (98%), Positives = 52/52 (100%) Frame = -3 Query: 261 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAR 106 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA+ Sbjct: 65 KLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK 116