BLASTX nr result
ID: Paeonia24_contig00004529
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00004529 (252 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006437732.1| hypothetical protein CICLE_v10032510mg [Citr... 60 2e-07 gb|EXB97179.1| Allene oxide cyclase 4 [Morus notabilis] 59 7e-07 ref|XP_007151755.1| hypothetical protein PHAVU_004G072000g [Phas... 59 9e-07 ref|XP_003637010.1| Allene-oxide cyclase [Medicago truncatula] g... 58 1e-06 ref|NP_001240078.1| allene oxide cyclase 3, chloroplastic-like [... 58 1e-06 ref|NP_001240200.1| membrane primary amine oxidase [Glycine max]... 58 1e-06 gb|AFK38605.1| unknown [Lotus japonicus] 58 2e-06 gb|ADY38579.1| allene oxide cyclase [Camellia sinensis] 58 2e-06 ref|XP_007223720.1| hypothetical protein PRUPE_ppa010397mg [Prun... 57 2e-06 gb|AFP87304.1| chloroplast allene oxide cyclase [Leymus mollis] 57 2e-06 gb|AFK41265.1| unknown [Lotus japonicus] 57 2e-06 ref|XP_003562363.1| PREDICTED: allene oxide cyclase 3, chloropla... 57 2e-06 ref|XP_003562362.1| PREDICTED: allene oxide cyclase 3, chloropla... 57 2e-06 ref|XP_003518680.1| PREDICTED: allene oxide cyclase 4, chloropla... 57 2e-06 gb|AEE99197.1| allene oxide cyclase 2 [Glycine max] 57 2e-06 gb|ACU19690.1| unknown [Glycine max] 57 2e-06 gb|EXB53999.1| Allene oxide cyclase 4 [Morus notabilis] 57 3e-06 ref|XP_006395626.1| hypothetical protein EUTSA_v10004810mg [Eutr... 57 3e-06 gb|EYU29945.1| hypothetical protein MIMGU_mgv1a012640mg [Mimulus... 57 3e-06 gb|AHA93095.1| allene oxide cyclase 1 [Triticum aestivum] 57 3e-06 >ref|XP_006437732.1| hypothetical protein CICLE_v10032510mg [Citrus clementina] gi|568861856|ref|XP_006484415.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Citrus sinensis] gi|557539928|gb|ESR50972.1| hypothetical protein CICLE_v10032510mg [Citrus clementina] Length = 257 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/48 (56%), Positives = 37/48 (77%) Frame = -3 Query: 148 YTS*LGGSVVFKGLYGQVRLYNIVYPMKKFYTFYLKGILALLMELIVE 5 Y + GGS +F+G+YGQV+L+ IV+P K FYTFYLKG+ L EL+V+ Sbjct: 182 YLAVTGGSGIFEGVYGQVKLHQIVFPYKLFYTFYLKGVADLPQELLVK 229 >gb|EXB97179.1| Allene oxide cyclase 4 [Morus notabilis] Length = 247 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/48 (56%), Positives = 36/48 (75%) Frame = -3 Query: 148 YTS*LGGSVVFKGLYGQVRLYNIVYPMKKFYTFYLKGILALLMELIVE 5 Y + GGS +F+G+YGQV+L I++P K FYTFYLKGI L EL+V+ Sbjct: 172 YLAVTGGSGIFEGVYGQVKLQQIIFPFKLFYTFYLKGIKDLPKELLVK 219 >ref|XP_007151755.1| hypothetical protein PHAVU_004G072000g [Phaseolus vulgaris] gi|561025064|gb|ESW23749.1| hypothetical protein PHAVU_004G072000g [Phaseolus vulgaris] Length = 253 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/49 (53%), Positives = 37/49 (75%) Frame = -3 Query: 157 QSFYTS*LGGSVVFKGLYGQVRLYNIVYPMKKFYTFYLKGILALLMELI 11 ++ Y + GGS +F+G+YGQV+L+ +V+P K FYTFYLKGI L EL+ Sbjct: 175 ENTYLAVTGGSGIFEGVYGQVKLHQLVFPFKLFYTFYLKGIKDLPQELL 223 >ref|XP_003637010.1| Allene-oxide cyclase [Medicago truncatula] gi|355502945|gb|AES84148.1| Allene-oxide cyclase [Medicago truncatula] Length = 249 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/66 (42%), Positives = 42/66 (63%) Frame = -3 Query: 205 GIFGNL*DHNQ*QAHNQSFYTS*LGGSVVFKGLYGQVRLYNIVYPMKKFYTFYLKGILAL 26 G +G++ + + Y + GG+ +F+G+YGQV+L+ IV+P K FYTFYLKGI L Sbjct: 155 GEYGHISVQGSYLTYEEDTYLAVTGGTGIFEGVYGQVKLHQIVFPFKIFYTFYLKGIKDL 214 Query: 25 LMELIV 8 E +V Sbjct: 215 PHEFLV 220 >ref|NP_001240078.1| allene oxide cyclase 3, chloroplastic-like [Glycine max] gi|332739620|gb|AEE99199.1| allene oxide cyclase 4 [Glycine max] Length = 253 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/46 (58%), Positives = 34/46 (73%) Frame = -3 Query: 148 YTS*LGGSVVFKGLYGQVRLYNIVYPMKKFYTFYLKGILALLMELI 11 Y + GGS +F+G YGQV+L+ IV+P K FYTFYLKGI L EL+ Sbjct: 178 YLAVTGGSGIFEGAYGQVKLHQIVFPFKLFYTFYLKGIKDLPQELL 223 >ref|NP_001240200.1| membrane primary amine oxidase [Glycine max] gi|332739618|gb|AEE99198.1| allene oxide cyclase 3 [Glycine max] Length = 257 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/46 (58%), Positives = 34/46 (73%) Frame = -3 Query: 148 YTS*LGGSVVFKGLYGQVRLYNIVYPMKKFYTFYLKGILALLMELI 11 Y + GGS +F+G YGQV+L+ IV+P K FYTFYLKGI L EL+ Sbjct: 182 YLAVTGGSGIFEGAYGQVKLHQIVFPFKLFYTFYLKGIKDLPQELL 227 >gb|AFK38605.1| unknown [Lotus japonicus] Length = 248 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/48 (56%), Positives = 35/48 (72%) Frame = -3 Query: 148 YTS*LGGSVVFKGLYGQVRLYNIVYPMKKFYTFYLKGILALLMELIVE 5 Y + GGS +F+G+YGQV+L IV+P K FYTFYLKGI L EL+ + Sbjct: 173 YLAVTGGSGIFEGVYGQVKLNQIVFPFKLFYTFYLKGIKDLPQELLAK 220 >gb|ADY38579.1| allene oxide cyclase [Camellia sinensis] Length = 245 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/41 (60%), Positives = 34/41 (82%) Frame = -3 Query: 133 GGSVVFKGLYGQVRLYNIVYPMKKFYTFYLKGILALLMELI 11 GGS +F+G+YGQV+L+ I++P K FYTFYLKGI L +EL+ Sbjct: 175 GGSGIFEGVYGQVKLHQIIFPFKLFYTFYLKGIPDLPVELL 215 >ref|XP_007223720.1| hypothetical protein PRUPE_ppa010397mg [Prunus persica] gi|462420656|gb|EMJ24919.1| hypothetical protein PRUPE_ppa010397mg [Prunus persica] Length = 251 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/45 (60%), Positives = 35/45 (77%) Frame = -3 Query: 148 YTS*LGGSVVFKGLYGQVRLYNIVYPMKKFYTFYLKGILALLMEL 14 Y + GGS +F+G+YGQV+L IV+P+K FYTFYLKGI L +EL Sbjct: 175 YLAVTGGSGIFEGVYGQVKLKQIVFPIKLFYTFYLKGISDLPVEL 219 >gb|AFP87304.1| chloroplast allene oxide cyclase [Leymus mollis] Length = 238 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/46 (60%), Positives = 34/46 (73%) Frame = -3 Query: 148 YTS*LGGSVVFKGLYGQVRLYNIVYPMKKFYTFYLKGILALLMELI 11 Y + GGS VF+G YGQV+L+ IV+P K FYTFYLKGI L EL+ Sbjct: 163 YLAVTGGSGVFEGAYGQVKLHQIVFPFKIFYTFYLKGIPDLPRELL 208 >gb|AFK41265.1| unknown [Lotus japonicus] Length = 256 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/49 (55%), Positives = 35/49 (71%) Frame = -3 Query: 157 QSFYTS*LGGSVVFKGLYGQVRLYNIVYPMKKFYTFYLKGILALLMELI 11 Q Y + GGS +F+G+YGQV+L +V+P K FYTFYLKGI L EL+ Sbjct: 178 QDTYLAVTGGSGIFEGVYGQVKLQQLVFPFKLFYTFYLKGIPDLPAELL 226 >ref|XP_003562363.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like isoform 2 [Brachypodium distachyon] Length = 256 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/46 (60%), Positives = 34/46 (73%) Frame = -3 Query: 148 YTS*LGGSVVFKGLYGQVRLYNIVYPMKKFYTFYLKGILALLMELI 11 Y + GGS VF+G YGQV+L+ IV+P K FYTFYLKGI L EL+ Sbjct: 181 YLAVTGGSGVFEGAYGQVKLHQIVFPFKIFYTFYLKGIPDLPRELL 226 >ref|XP_003562362.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like isoform 1 [Brachypodium distachyon] Length = 243 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/46 (60%), Positives = 34/46 (73%) Frame = -3 Query: 148 YTS*LGGSVVFKGLYGQVRLYNIVYPMKKFYTFYLKGILALLMELI 11 Y + GGS VF+G YGQV+L+ IV+P K FYTFYLKGI L EL+ Sbjct: 168 YLAVTGGSGVFEGAYGQVKLHQIVFPFKIFYTFYLKGIPDLPRELL 213 >ref|XP_003518680.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Glycine max] Length = 255 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/49 (53%), Positives = 36/49 (73%) Frame = -3 Query: 157 QSFYTS*LGGSVVFKGLYGQVRLYNIVYPMKKFYTFYLKGILALLMELI 11 Q Y + GGS +F+G+YGQV+L+ +V+P K FYTFYLKG+ L EL+ Sbjct: 177 QDTYLAVSGGSGIFEGVYGQVKLHQLVFPFKLFYTFYLKGVPDLPPELL 225 >gb|AEE99197.1| allene oxide cyclase 2 [Glycine max] Length = 255 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/49 (53%), Positives = 36/49 (73%) Frame = -3 Query: 157 QSFYTS*LGGSVVFKGLYGQVRLYNIVYPMKKFYTFYLKGILALLMELI 11 Q Y + GGS +F+G+YGQV+L+ +V+P K FYTFYLKG+ L EL+ Sbjct: 177 QDTYLAVSGGSGIFEGVYGQVKLHQLVFPFKLFYTFYLKGVPDLPPELL 225 >gb|ACU19690.1| unknown [Glycine max] Length = 255 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/49 (53%), Positives = 36/49 (73%) Frame = -3 Query: 157 QSFYTS*LGGSVVFKGLYGQVRLYNIVYPMKKFYTFYLKGILALLMELI 11 Q Y + GGS +F+G+YGQV+L+ +V+P K FYTFYLKG+ L EL+ Sbjct: 177 QDTYLAVSGGSGIFEGVYGQVKLHQLVFPFKLFYTFYLKGVPDLPPELL 225 >gb|EXB53999.1| Allene oxide cyclase 4 [Morus notabilis] Length = 255 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/49 (55%), Positives = 34/49 (69%) Frame = -3 Query: 157 QSFYTS*LGGSVVFKGLYGQVRLYNIVYPMKKFYTFYLKGILALLMELI 11 Q Y + GGS +F+G YGQV+L +V+P K FYTFYLKGI L EL+ Sbjct: 177 QDTYLAVTGGSGIFEGAYGQVKLQQLVFPFKIFYTFYLKGIRDLPQELL 225 >ref|XP_006395626.1| hypothetical protein EUTSA_v10004810mg [Eutrema salsugineum] gi|557092265|gb|ESQ32912.1| hypothetical protein EUTSA_v10004810mg [Eutrema salsugineum] Length = 252 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/48 (56%), Positives = 34/48 (70%) Frame = -3 Query: 157 QSFYTS*LGGSVVFKGLYGQVRLYNIVYPMKKFYTFYLKGILALLMEL 14 Q + + GGS +F+G YGQV+L +VYP K FYTFYLKGI L +EL Sbjct: 174 QDTFLAVTGGSGIFEGAYGQVKLRQLVYPTKLFYTFYLKGIADLPLEL 221 >gb|EYU29945.1| hypothetical protein MIMGU_mgv1a012640mg [Mimulus guttatus] Length = 244 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = -3 Query: 133 GGSVVFKGLYGQVRLYNIVYPMKKFYTFYLKGILALLMELIV 8 GGS VF+G+YG V+L IV+P K FYTFYLKGI L EL+V Sbjct: 174 GGSGVFEGVYGSVKLKQIVFPFKLFYTFYLKGIKDLPAELVV 215 >gb|AHA93095.1| allene oxide cyclase 1 [Triticum aestivum] Length = 239 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/46 (60%), Positives = 34/46 (73%) Frame = -3 Query: 148 YTS*LGGSVVFKGLYGQVRLYNIVYPMKKFYTFYLKGILALLMELI 11 Y + GGS VF+G+YGQV+L IV+P K FYTFYLKGI L EL+ Sbjct: 163 YLAVTGGSGVFEGVYGQVKLNQIVFPFKIFYTFYLKGIPDLPKELL 208