BLASTX nr result
ID: Paeonia24_contig00004049
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00004049 (317 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003634944.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_004141361.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 ref|XP_007019869.1| Pentatricopeptide repeat superfamily protein... 57 3e-06 >ref|XP_003634944.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial-like [Vitis vinifera] Length = 582 Score = 64.3 bits (155), Expect = 2e-08 Identities = 33/55 (60%), Positives = 39/55 (70%) Frame = +3 Query: 9 AQKILIEMMDKGLRPHLPVYMKVLRQLQKFRRGDLASDLKIRFSGLSLGPCTETG 173 AQKILIEM++KGL+P+ VY +VL L K R DLA DL+ RFS LS TETG Sbjct: 528 AQKILIEMIEKGLKPNFSVYKRVLEHLDKSGREDLAGDLRSRFSSLSFQSSTETG 582 >ref|XP_004141361.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like [Cucumis sativus] gi|449498723|ref|XP_004160616.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like [Cucumis sativus] Length = 494 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/48 (58%), Positives = 37/48 (77%) Frame = +3 Query: 9 AQKILIEMMDKGLRPHLPVYMKVLRQLQKFRRGDLASDLKIRFSGLSL 152 AQKIL E+MD GL+PH VY ++L++LQ RGDLA+DLK + S +SL Sbjct: 440 AQKILSELMDAGLKPHFHVYTRLLKKLQVQGRGDLANDLKRKISNVSL 487 >ref|XP_007019869.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma cacao] gi|508725197|gb|EOY17094.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma cacao] Length = 494 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/57 (50%), Positives = 38/57 (66%) Frame = +3 Query: 3 LIAQKILIEMMDKGLRPHLPVYMKVLRQLQKFRRGDLASDLKIRFSGLSLGPCTETG 173 +IAQ IL EM++KGL+P+ VYM V +QLQK R DLA +L+ FS L P + G Sbjct: 438 VIAQSILSEMIEKGLKPNFAVYMTVTKQLQKSGREDLAGNLRSSFSSLISQPSADNG 494