BLASTX nr result
ID: Paeonia24_contig00003032
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00003032 (1221 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006357534.1| PREDICTED: uncharacterized protein LOC102584... 59 6e-06 gb|AFW90579.1| hypothetical protein [Solanum tuberosum] 59 6e-06 >ref|XP_006357534.1| PREDICTED: uncharacterized protein LOC102584541 [Solanum tuberosum] Length = 96 Score = 58.5 bits (140), Expect = 6e-06 Identities = 25/44 (56%), Positives = 33/44 (75%) Frame = +1 Query: 823 LRPMCGLFRSVLGGFLESGNGDEKITLAEDSLRRVMYLSCWGPN 954 LRPM G+ S +GGF+ G G+EK ++SLR+VMYLSCWGP+ Sbjct: 53 LRPMSGMLGSDVGGFIGGGKGEEKRKQTDESLRQVMYLSCWGPS 96 >gb|AFW90579.1| hypothetical protein [Solanum tuberosum] Length = 96 Score = 58.5 bits (140), Expect = 6e-06 Identities = 25/44 (56%), Positives = 33/44 (75%) Frame = +1 Query: 823 LRPMCGLFRSVLGGFLESGNGDEKITLAEDSLRRVMYLSCWGPN 954 LRPM G+ S +GGF+ G G+EK ++SLR+VMYLSCWGP+ Sbjct: 53 LRPMSGMLGSDVGGFIGGGKGEEKRKQTDESLRQVMYLSCWGPS 96