BLASTX nr result
ID: Paeonia24_contig00003004
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00003004 (511 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007207700.1| hypothetical protein PRUPE_ppa024193mg, part... 55 8e-06 >ref|XP_007207700.1| hypothetical protein PRUPE_ppa024193mg, partial [Prunus persica] gi|462403342|gb|EMJ08899.1| hypothetical protein PRUPE_ppa024193mg, partial [Prunus persica] Length = 519 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = +1 Query: 22 YTVGFGLYYIDYSDDFKRIPKKSANWFKDFL 114 YTV FG+YY+DY D+ KR PK SANWFK+FL Sbjct: 485 YTVRFGIYYVDYKDELKRYPKLSANWFKNFL 515