BLASTX nr result
ID: Paeonia24_contig00002835
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00002835 (233 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004136332.1| PREDICTED: RING finger and CHY zinc finger d... 62 3e-13 ref|XP_002284652.1| PREDICTED: RING finger and CHY zinc finger d... 61 5e-13 emb|CBI20950.3| unnamed protein product [Vitis vinifera] 61 5e-13 ref|XP_006356627.1| PREDICTED: RING finger and CHY zinc finger d... 60 6e-13 ref|XP_004245246.1| PREDICTED: RING finger and CHY zinc finger d... 60 6e-13 ref|XP_003569693.1| PREDICTED: RING finger and CHY zinc finger d... 60 1e-12 gb|ACG32069.1| RING finger and CHY zinc finger domain-containing... 60 1e-12 ref|NP_001146901.1| RING finger and CHY zinc finger domain-conta... 60 1e-12 ref|XP_006644631.1| PREDICTED: RING finger and CHY zinc finger d... 59 2e-12 gb|EMT31343.1| RING finger and CHY zinc finger domain-containing... 59 2e-12 gb|EMS60697.1| RING finger and CHY zinc finger domain-containing... 59 2e-12 dbj|BAJ84835.1| predicted protein [Hordeum vulgare subsp. vulgare] 59 2e-12 dbj|BAJ84990.1| predicted protein [Hordeum vulgare subsp. vulgare] 59 2e-12 ref|XP_006601111.1| PREDICTED: RING finger and CHY zinc finger d... 58 3e-12 ref|XP_003544629.1| PREDICTED: RING finger and CHY zinc finger d... 58 3e-12 ref|XP_006601113.1| PREDICTED: RING finger and CHY zinc finger d... 58 3e-12 gb|ABF13303.1| ubiqutin ligase [Phaseolus vulgaris] 58 3e-12 gb|EEC71394.1| hypothetical protein OsI_03534 [Oryza sativa Indi... 58 4e-12 ref|XP_004969767.1| PREDICTED: RING finger and CHY zinc finger d... 58 4e-12 ref|NP_001044081.1| Os01g0719100 [Oryza sativa Japonica Group] g... 58 4e-12 >ref|XP_004136332.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like [Cucumis sativus] gi|449505475|ref|XP_004162482.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like [Cucumis sativus] Length = 307 Score = 61.6 bits (148), Expect(2) = 3e-13 Identities = 22/36 (61%), Positives = 32/36 (88%) Frame = -1 Query: 110 CFCCWQYLFDTLDDVSVLPCGHTIHYNCLQQMKEHF 3 C C++YLFD+ +DV+V+PCGHTIH NCL++M++HF Sbjct: 198 CPVCFEYLFDSTNDVTVMPCGHTIHQNCLKEMRDHF 233 Score = 38.9 bits (89), Expect(2) = 3e-13 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 231 VEGAMHHDCPVCFEVKF 181 VEGAMHHDCPVCFE F Sbjct: 190 VEGAMHHDCPVCFEYLF 206 >ref|XP_002284652.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1 [Vitis vinifera] gi|147785653|emb|CAN68688.1| hypothetical protein VITISV_029477 [Vitis vinifera] Length = 315 Score = 60.8 bits (146), Expect(2) = 5e-13 Identities = 22/35 (62%), Positives = 31/35 (88%) Frame = -1 Query: 110 CFCCWQYLFDTLDDVSVLPCGHTIHYNCLQQMKEH 6 C C++YLF++ DDV+V+PCGHTIH NCL++M+EH Sbjct: 206 CPVCFEYLFESTDDVTVMPCGHTIHQNCLKEMREH 240 Score = 38.9 bits (89), Expect(2) = 5e-13 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 231 VEGAMHHDCPVCFEVKF 181 VEGAMHHDCPVCFE F Sbjct: 198 VEGAMHHDCPVCFEYLF 214 >emb|CBI20950.3| unnamed protein product [Vitis vinifera] Length = 294 Score = 60.8 bits (146), Expect(2) = 5e-13 Identities = 22/35 (62%), Positives = 31/35 (88%) Frame = -1 Query: 110 CFCCWQYLFDTLDDVSVLPCGHTIHYNCLQQMKEH 6 C C++YLF++ DDV+V+PCGHTIH NCL++M+EH Sbjct: 185 CPVCFEYLFESTDDVTVMPCGHTIHQNCLKEMREH 219 Score = 38.9 bits (89), Expect(2) = 5e-13 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 231 VEGAMHHDCPVCFEVKF 181 VEGAMHHDCPVCFE F Sbjct: 177 VEGAMHHDCPVCFEYLF 193 >ref|XP_006356627.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like isoform X1 [Solanum tuberosum] gi|565380484|ref|XP_006356628.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like isoform X2 [Solanum tuberosum] Length = 311 Score = 60.5 bits (145), Expect(2) = 6e-13 Identities = 21/36 (58%), Positives = 33/36 (91%) Frame = -1 Query: 110 CFCCWQYLFDTLDDVSVLPCGHTIHYNCLQQMKEHF 3 C C++YLF++++DV+V+PCGHTIH NCL++M+EH+ Sbjct: 201 CPVCFEYLFESINDVTVMPCGHTIHKNCLKEMQEHY 236 Score = 38.9 bits (89), Expect(2) = 6e-13 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 231 VEGAMHHDCPVCFEVKF 181 VEGAMHHDCPVCFE F Sbjct: 193 VEGAMHHDCPVCFEYLF 209 >ref|XP_004245246.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like isoform 1 [Solanum lycopersicum] gi|460399437|ref|XP_004245247.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like isoform 2 [Solanum lycopersicum] Length = 311 Score = 60.5 bits (145), Expect(2) = 6e-13 Identities = 21/36 (58%), Positives = 33/36 (91%) Frame = -1 Query: 110 CFCCWQYLFDTLDDVSVLPCGHTIHYNCLQQMKEHF 3 C C++YLF++++DV+V+PCGHTIH NCL++M+EH+ Sbjct: 201 CPVCFEYLFESINDVTVMPCGHTIHKNCLKEMQEHY 236 Score = 38.9 bits (89), Expect(2) = 6e-13 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 231 VEGAMHHDCPVCFEVKF 181 VEGAMHHDCPVCFE F Sbjct: 193 VEGAMHHDCPVCFEYLF 209 >ref|XP_003569693.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like [Brachypodium distachyon] Length = 296 Score = 60.1 bits (144), Expect(2) = 1e-12 Identities = 23/35 (65%), Positives = 31/35 (88%) Frame = -1 Query: 110 CFCCWQYLFDTLDDVSVLPCGHTIHYNCLQQMKEH 6 C C++YLF++ +DVSVLPCGHTIH NCL++M+EH Sbjct: 191 CPICFEYLFESTNDVSVLPCGHTIHENCLKEMEEH 225 Score = 38.5 bits (88), Expect(2) = 1e-12 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -3 Query: 231 VEGAMHHDCPVCFEVKF 181 VEGAMHHDCP+CFE F Sbjct: 183 VEGAMHHDCPICFEYLF 199 >gb|ACG32069.1| RING finger and CHY zinc finger domain-containing protein 1 [Zea mays] Length = 300 Score = 59.7 bits (143), Expect(2) = 1e-12 Identities = 23/35 (65%), Positives = 30/35 (85%) Frame = -1 Query: 110 CFCCWQYLFDTLDDVSVLPCGHTIHYNCLQQMKEH 6 C C++YLFD+ +DVSVLPCGHTIH CL++M+EH Sbjct: 195 CPICFEYLFDSTNDVSVLPCGHTIHVKCLKEMEEH 229 Score = 38.5 bits (88), Expect(2) = 1e-12 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -3 Query: 231 VEGAMHHDCPVCFEVKF 181 VEGAMHHDCP+CFE F Sbjct: 187 VEGAMHHDCPICFEYLF 203 >ref|NP_001146901.1| RING finger and CHY zinc finger domain-containing protein 1 [Zea mays] gi|195604946|gb|ACG24303.1| RING finger and CHY zinc finger domain-containing protein 1 [Zea mays] gi|219887007|gb|ACL53878.1| unknown [Zea mays] gi|414880699|tpg|DAA57830.1| TPA: putative RING zinc finger domain superfamily protein isoform 1 [Zea mays] gi|414880700|tpg|DAA57831.1| TPA: putative RING zinc finger domain superfamily protein isoform 2 [Zea mays] gi|414880701|tpg|DAA57832.1| TPA: putative RING zinc finger domain superfamily protein isoform 3 [Zea mays] gi|414880702|tpg|DAA57833.1| TPA: putative RING zinc finger domain superfamily protein isoform 4 [Zea mays] gi|414880703|tpg|DAA57834.1| TPA: putative RING zinc finger domain superfamily protein isoform 5 [Zea mays] Length = 300 Score = 59.7 bits (143), Expect(2) = 1e-12 Identities = 23/35 (65%), Positives = 30/35 (85%) Frame = -1 Query: 110 CFCCWQYLFDTLDDVSVLPCGHTIHYNCLQQMKEH 6 C C++YLFD+ +DVSVLPCGHTIH CL++M+EH Sbjct: 195 CPICFEYLFDSTNDVSVLPCGHTIHVKCLKEMEEH 229 Score = 38.5 bits (88), Expect(2) = 1e-12 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -3 Query: 231 VEGAMHHDCPVCFEVKF 181 VEGAMHHDCP+CFE F Sbjct: 187 VEGAMHHDCPICFEYLF 203 >ref|XP_006644631.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like [Oryza brachyantha] Length = 334 Score = 59.3 bits (142), Expect(2) = 2e-12 Identities = 23/35 (65%), Positives = 30/35 (85%) Frame = -1 Query: 110 CFCCWQYLFDTLDDVSVLPCGHTIHYNCLQQMKEH 6 C C++YLF++ +DVSVLPCGHTIH CLQ+M+EH Sbjct: 229 CPICFEYLFNSTNDVSVLPCGHTIHVKCLQEMEEH 263 Score = 38.5 bits (88), Expect(2) = 2e-12 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -3 Query: 231 VEGAMHHDCPVCFEVKF 181 VEGAMHHDCP+CFE F Sbjct: 221 VEGAMHHDCPICFEYLF 237 >gb|EMT31343.1| RING finger and CHY zinc finger domain-containing protein 1 [Aegilops tauschii] Length = 326 Score = 58.9 bits (141), Expect(2) = 2e-12 Identities = 23/35 (65%), Positives = 30/35 (85%) Frame = -1 Query: 110 CFCCWQYLFDTLDDVSVLPCGHTIHYNCLQQMKEH 6 C C++YLF++ +DVSVLPCGHTIH CL++MKEH Sbjct: 221 CPICFEYLFESRNDVSVLPCGHTIHEKCLKEMKEH 255 Score = 38.5 bits (88), Expect(2) = 2e-12 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -3 Query: 231 VEGAMHHDCPVCFEVKF 181 VEGAMHHDCP+CFE F Sbjct: 213 VEGAMHHDCPICFEYLF 229 >gb|EMS60697.1| RING finger and CHY zinc finger domain-containing protein 1 [Triticum urartu] Length = 299 Score = 58.9 bits (141), Expect(2) = 2e-12 Identities = 23/35 (65%), Positives = 30/35 (85%) Frame = -1 Query: 110 CFCCWQYLFDTLDDVSVLPCGHTIHYNCLQQMKEH 6 C C++YLF++ +DVSVLPCGHTIH CL++MKEH Sbjct: 194 CPICFEYLFESRNDVSVLPCGHTIHEKCLKEMKEH 228 Score = 38.5 bits (88), Expect(2) = 2e-12 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -3 Query: 231 VEGAMHHDCPVCFEVKF 181 VEGAMHHDCP+CFE F Sbjct: 186 VEGAMHHDCPICFEYLF 202 >dbj|BAJ84835.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 247 Score = 58.9 bits (141), Expect(2) = 2e-12 Identities = 23/35 (65%), Positives = 30/35 (85%) Frame = -1 Query: 110 CFCCWQYLFDTLDDVSVLPCGHTIHYNCLQQMKEH 6 C C++YLF++ +DVSVLPCGHTIH CL++MKEH Sbjct: 142 CPICFEYLFESRNDVSVLPCGHTIHEKCLKEMKEH 176 Score = 38.5 bits (88), Expect(2) = 2e-12 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -3 Query: 231 VEGAMHHDCPVCFEVKF 181 VEGAMHHDCP+CFE F Sbjct: 134 VEGAMHHDCPICFEYLF 150 >dbj|BAJ84990.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 245 Score = 58.9 bits (141), Expect(2) = 2e-12 Identities = 23/35 (65%), Positives = 30/35 (85%) Frame = -1 Query: 110 CFCCWQYLFDTLDDVSVLPCGHTIHYNCLQQMKEH 6 C C++YLF++ +DVSVLPCGHTIH CL++MKEH Sbjct: 140 CPICFEYLFESRNDVSVLPCGHTIHEKCLKEMKEH 174 Score = 38.5 bits (88), Expect(2) = 2e-12 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -3 Query: 231 VEGAMHHDCPVCFEVKF 181 VEGAMHHDCP+CFE F Sbjct: 132 VEGAMHHDCPICFEYLF 148 >ref|XP_006601111.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like isoform X1 [Glycine max] gi|571538178|ref|XP_006601112.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like isoform X2 [Glycine max] Length = 308 Score = 58.2 bits (139), Expect(2) = 3e-12 Identities = 21/36 (58%), Positives = 31/36 (86%) Frame = -1 Query: 110 CFCCWQYLFDTLDDVSVLPCGHTIHYNCLQQMKEHF 3 C C++YLF++ +DV+V+PCGHTIH +CL +M+EHF Sbjct: 201 CPVCFEYLFESRNDVTVMPCGHTIHKSCLNEMREHF 236 Score = 38.9 bits (89), Expect(2) = 3e-12 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 231 VEGAMHHDCPVCFEVKF 181 VEGAMHHDCPVCFE F Sbjct: 193 VEGAMHHDCPVCFEYLF 209 >ref|XP_003544629.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like isoformX1 [Glycine max] gi|571509454|ref|XP_006596128.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like isoform X2 [Glycine max] Length = 308 Score = 58.2 bits (139), Expect(2) = 3e-12 Identities = 21/36 (58%), Positives = 31/36 (86%) Frame = -1 Query: 110 CFCCWQYLFDTLDDVSVLPCGHTIHYNCLQQMKEHF 3 C C++YLF++ +DV+V+PCGHTIH +CL +M+EHF Sbjct: 201 CPVCFEYLFESRNDVTVMPCGHTIHKSCLNEMREHF 236 Score = 38.9 bits (89), Expect(2) = 3e-12 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 231 VEGAMHHDCPVCFEVKF 181 VEGAMHHDCPVCFE F Sbjct: 193 VEGAMHHDCPVCFEYLF 209 >ref|XP_006601113.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like isoform X3 [Glycine max] Length = 218 Score = 58.2 bits (139), Expect(2) = 3e-12 Identities = 21/36 (58%), Positives = 31/36 (86%) Frame = -1 Query: 110 CFCCWQYLFDTLDDVSVLPCGHTIHYNCLQQMKEHF 3 C C++YLF++ +DV+V+PCGHTIH +CL +M+EHF Sbjct: 111 CPVCFEYLFESRNDVTVMPCGHTIHKSCLNEMREHF 146 Score = 38.9 bits (89), Expect(2) = 3e-12 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 231 VEGAMHHDCPVCFEVKF 181 VEGAMHHDCPVCFE F Sbjct: 103 VEGAMHHDCPVCFEYLF 119 >gb|ABF13303.1| ubiqutin ligase [Phaseolus vulgaris] Length = 155 Score = 58.2 bits (139), Expect(2) = 3e-12 Identities = 21/36 (58%), Positives = 31/36 (86%) Frame = -1 Query: 110 CFCCWQYLFDTLDDVSVLPCGHTIHYNCLQQMKEHF 3 C C++YLF++ +DV+V+PCGHTIH +CL +M+EHF Sbjct: 48 CPVCFEYLFESRNDVTVMPCGHTIHKSCLNEMREHF 83 Score = 38.9 bits (89), Expect(2) = 3e-12 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 231 VEGAMHHDCPVCFEVKF 181 VEGAMHHDCPVCFE F Sbjct: 40 VEGAMHHDCPVCFEYLF 56 >gb|EEC71394.1| hypothetical protein OsI_03534 [Oryza sativa Indica Group] Length = 303 Score = 58.2 bits (139), Expect(2) = 4e-12 Identities = 22/35 (62%), Positives = 30/35 (85%) Frame = -1 Query: 110 CFCCWQYLFDTLDDVSVLPCGHTIHYNCLQQMKEH 6 C C++YLF++ +DVSVLPCGHTIH CL++M+EH Sbjct: 192 CPICFEYLFESTNDVSVLPCGHTIHVKCLREMEEH 226 Score = 38.5 bits (88), Expect(2) = 4e-12 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -3 Query: 231 VEGAMHHDCPVCFEVKF 181 VEGAMHHDCP+CFE F Sbjct: 184 VEGAMHHDCPICFEYLF 200 >ref|XP_004969767.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like isoform X1 [Setaria italica] gi|514781137|ref|XP_004969768.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like isoform X2 [Setaria italica] gi|514781141|ref|XP_004969769.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like isoform X3 [Setaria italica] Length = 302 Score = 58.2 bits (139), Expect(2) = 4e-12 Identities = 22/35 (62%), Positives = 30/35 (85%) Frame = -1 Query: 110 CFCCWQYLFDTLDDVSVLPCGHTIHYNCLQQMKEH 6 C C++YLF++ +DVSVLPCGHTIH CL++M+EH Sbjct: 197 CPICFEYLFESTNDVSVLPCGHTIHVKCLKEMEEH 231 Score = 38.5 bits (88), Expect(2) = 4e-12 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -3 Query: 231 VEGAMHHDCPVCFEVKF 181 VEGAMHHDCP+CFE F Sbjct: 189 VEGAMHHDCPICFEYLF 205 >ref|NP_001044081.1| Os01g0719100 [Oryza sativa Japonica Group] gi|57899891|dbj|BAD87761.1| zinc finger protein ZFP-like [Oryza sativa Japonica Group] gi|113533612|dbj|BAF05995.1| Os01g0719100 [Oryza sativa Japonica Group] gi|347737081|gb|AEP20520.1| zinc finger protein [Oryza sativa Japonica Group] Length = 302 Score = 58.2 bits (139), Expect(2) = 4e-12 Identities = 22/35 (62%), Positives = 30/35 (85%) Frame = -1 Query: 110 CFCCWQYLFDTLDDVSVLPCGHTIHYNCLQQMKEH 6 C C++YLF++ +DVSVLPCGHTIH CL++M+EH Sbjct: 197 CPICFEYLFESTNDVSVLPCGHTIHVKCLREMEEH 231 Score = 38.5 bits (88), Expect(2) = 4e-12 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -3 Query: 231 VEGAMHHDCPVCFEVKF 181 VEGAMHHDCP+CFE F Sbjct: 189 VEGAMHHDCPICFEYLF 205