BLASTX nr result
ID: Paeonia24_contig00002260
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00002260 (207 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002264089.2| PREDICTED: eukaryotic translation initiation... 132 4e-29 ref|XP_006347028.1| PREDICTED: eukaryotic translation initiation... 132 5e-29 ref|XP_004232885.1| PREDICTED: eukaryotic translation initiation... 132 5e-29 ref|XP_004134552.1| PREDICTED: eukaryotic translation initiation... 132 5e-29 gb|ACJ85719.1| unknown [Medicago truncatula] 131 9e-29 ref|XP_007148150.1| hypothetical protein PHAVU_006G184500g [Phas... 131 1e-28 ref|XP_002509464.1| eukaryotic translation initiation factor 3 s... 130 1e-28 ref|XP_007211881.1| hypothetical protein PRUPE_ppa003548mg [Prun... 130 2e-28 ref|XP_003545990.1| PREDICTED: eukaryotic translation initiation... 130 2e-28 ref|XP_003543041.1| PREDICTED: eukaryotic translation initiation... 129 3e-28 ref|XP_004485789.1| PREDICTED: eukaryotic translation initiation... 129 4e-28 ref|XP_007025596.1| Eukaryotic translation initiation factor 3 s... 128 7e-28 ref|XP_006467784.1| PREDICTED: eukaryotic translation initiation... 127 2e-27 ref|XP_006449357.1| hypothetical protein CICLE_v10017475mg [Citr... 127 2e-27 gb|EYU27980.1| hypothetical protein MIMGU_mgv1a003522mg [Mimulus... 126 3e-27 gb|EXB30288.1| Eukaryotic translation initiation factor 3 subuni... 125 5e-27 ref|XP_002305792.2| hypothetical protein POPTR_0004s044402g, par... 125 5e-27 ref|XP_006377371.1| Eukaryotic translation initiation factor 3 s... 125 8e-27 gb|EPS68309.1| hypothetical protein M569_06452, partial [Genlise... 124 1e-26 gb|EYU43387.1| hypothetical protein MIMGU_mgv1a003500mg [Mimulus... 124 2e-26 >ref|XP_002264089.2| PREDICTED: eukaryotic translation initiation factor 3 subunit D-like [Vitis vinifera] Length = 567 Score = 132 bits (333), Expect = 4e-29 Identities = 65/68 (95%), Positives = 65/68 (95%) Frame = +3 Query: 3 LLLCGGLESYDRSYDRVTPNNERRLERFKNRNFFKVTTTDDPVIRRLANEDKATVFATDS 182 LLLCG LE YDRSYDRVTP NERRLERFKNRNFFKVTTTDDPVIRRLANEDKATVFATDS Sbjct: 193 LLLCGALEFYDRSYDRVTPKNERRLERFKNRNFFKVTTTDDPVIRRLANEDKATVFATDS 252 Query: 183 ILSTLMCA 206 ILSTLMCA Sbjct: 253 ILSTLMCA 260 >ref|XP_006347028.1| PREDICTED: eukaryotic translation initiation factor 3 subunit D-like [Solanum tuberosum] Length = 576 Score = 132 bits (332), Expect = 5e-29 Identities = 62/68 (91%), Positives = 66/68 (97%) Frame = +3 Query: 3 LLLCGGLESYDRSYDRVTPNNERRLERFKNRNFFKVTTTDDPVIRRLANEDKATVFATDS 182 LL+CGGLE YDRSYDR+TP NERRLERFKNRNFFK+TTTDDPVIRRLANEDKATVFATD+ Sbjct: 201 LLICGGLEFYDRSYDRITPKNERRLERFKNRNFFKITTTDDPVIRRLANEDKATVFATDT 260 Query: 183 ILSTLMCA 206 ILSTLMCA Sbjct: 261 ILSTLMCA 268 >ref|XP_004232885.1| PREDICTED: eukaryotic translation initiation factor 3 subunit D-like isoform 1 [Solanum lycopersicum] gi|460374173|ref|XP_004232886.1| PREDICTED: eukaryotic translation initiation factor 3 subunit D-like isoform 2 [Solanum lycopersicum] gi|460374175|ref|XP_004232887.1| PREDICTED: eukaryotic translation initiation factor 3 subunit D-like isoform 3 [Solanum lycopersicum] Length = 577 Score = 132 bits (332), Expect = 5e-29 Identities = 62/68 (91%), Positives = 66/68 (97%) Frame = +3 Query: 3 LLLCGGLESYDRSYDRVTPNNERRLERFKNRNFFKVTTTDDPVIRRLANEDKATVFATDS 182 LL+CGGLE YDRSYDR+TP NERRLERFKNRNFFK+TTTDDPVIRRLANEDKATVFATD+ Sbjct: 201 LLICGGLEFYDRSYDRITPKNERRLERFKNRNFFKITTTDDPVIRRLANEDKATVFATDT 260 Query: 183 ILSTLMCA 206 ILSTLMCA Sbjct: 261 ILSTLMCA 268 >ref|XP_004134552.1| PREDICTED: eukaryotic translation initiation factor 3 subunit D-like [Cucumis sativus] gi|449506762|ref|XP_004162841.1| PREDICTED: eukaryotic translation initiation factor 3 subunit D-like [Cucumis sativus] Length = 566 Score = 132 bits (332), Expect = 5e-29 Identities = 63/68 (92%), Positives = 66/68 (97%) Frame = +3 Query: 3 LLLCGGLESYDRSYDRVTPNNERRLERFKNRNFFKVTTTDDPVIRRLANEDKATVFATDS 182 LLLCGGLE YDR+YDR+TP NERRLERFKNRNFFKVTTTDDPVIRRLANEDKATVFATD+ Sbjct: 192 LLLCGGLEFYDRAYDRITPKNERRLERFKNRNFFKVTTTDDPVIRRLANEDKATVFATDA 251 Query: 183 ILSTLMCA 206 ILSTLMCA Sbjct: 252 ILSTLMCA 259 >gb|ACJ85719.1| unknown [Medicago truncatula] Length = 297 Score = 131 bits (330), Expect = 9e-29 Identities = 63/68 (92%), Positives = 65/68 (95%) Frame = +3 Query: 3 LLLCGGLESYDRSYDRVTPNNERRLERFKNRNFFKVTTTDDPVIRRLANEDKATVFATDS 182 LLLCG LESYDRSYDR+ P NERRLERFKNRNFFKVTTTDDPVIRRLANEDKATVFATD+ Sbjct: 186 LLLCGALESYDRSYDRIAPKNERRLERFKNRNFFKVTTTDDPVIRRLANEDKATVFATDA 245 Query: 183 ILSTLMCA 206 ILSTLMCA Sbjct: 246 ILSTLMCA 253 >ref|XP_007148150.1| hypothetical protein PHAVU_006G184500g [Phaseolus vulgaris] gi|561021373|gb|ESW20144.1| hypothetical protein PHAVU_006G184500g [Phaseolus vulgaris] Length = 563 Score = 131 bits (329), Expect = 1e-28 Identities = 63/68 (92%), Positives = 65/68 (95%) Frame = +3 Query: 3 LLLCGGLESYDRSYDRVTPNNERRLERFKNRNFFKVTTTDDPVIRRLANEDKATVFATDS 182 LLLCG LE YDRSYDR+TP NERRLERFKNRNFFKVTTTDDPVIRRLANEDKATVFATD+ Sbjct: 190 LLLCGALEYYDRSYDRITPKNERRLERFKNRNFFKVTTTDDPVIRRLANEDKATVFATDT 249 Query: 183 ILSTLMCA 206 ILSTLMCA Sbjct: 250 ILSTLMCA 257 >ref|XP_002509464.1| eukaryotic translation initiation factor 3 subunit, putative [Ricinus communis] gi|223549363|gb|EEF50851.1| eukaryotic translation initiation factor 3 subunit, putative [Ricinus communis] Length = 574 Score = 130 bits (328), Expect = 1e-28 Identities = 62/68 (91%), Positives = 66/68 (97%) Frame = +3 Query: 3 LLLCGGLESYDRSYDRVTPNNERRLERFKNRNFFKVTTTDDPVIRRLANEDKATVFATDS 182 LLLCGGLE YDRS+DR+TP NERRLERFKNRNFFKVTTTDDPVIRRLANEDKATVFATD+ Sbjct: 200 LLLCGGLEFYDRSFDRITPKNERRLERFKNRNFFKVTTTDDPVIRRLANEDKATVFATDT 259 Query: 183 ILSTLMCA 206 IL+TLMCA Sbjct: 260 ILATLMCA 267 >ref|XP_007211881.1| hypothetical protein PRUPE_ppa003548mg [Prunus persica] gi|462407746|gb|EMJ13080.1| hypothetical protein PRUPE_ppa003548mg [Prunus persica] Length = 566 Score = 130 bits (326), Expect = 2e-28 Identities = 63/68 (92%), Positives = 65/68 (95%) Frame = +3 Query: 3 LLLCGGLESYDRSYDRVTPNNERRLERFKNRNFFKVTTTDDPVIRRLANEDKATVFATDS 182 LLLCGGLE YDRS DR+TP NERRLERFKNRNFFKVTTTDDPVIRRLANEDKATVFATD+ Sbjct: 191 LLLCGGLEFYDRSCDRITPKNERRLERFKNRNFFKVTTTDDPVIRRLANEDKATVFATDT 250 Query: 183 ILSTLMCA 206 ILSTLMCA Sbjct: 251 ILSTLMCA 258 >ref|XP_003545990.1| PREDICTED: eukaryotic translation initiation factor 3 subunit D-like isoform 1 [Glycine max] Length = 565 Score = 130 bits (326), Expect = 2e-28 Identities = 62/68 (91%), Positives = 65/68 (95%) Frame = +3 Query: 3 LLLCGGLESYDRSYDRVTPNNERRLERFKNRNFFKVTTTDDPVIRRLANEDKATVFATDS 182 LLLCG LE YDR+YDR+TP NERRLERFKNRNFFKVTTTDDPVIRRLANEDKATVFATD+ Sbjct: 191 LLLCGALEYYDRTYDRITPKNERRLERFKNRNFFKVTTTDDPVIRRLANEDKATVFATDT 250 Query: 183 ILSTLMCA 206 ILSTLMCA Sbjct: 251 ILSTLMCA 258 >ref|XP_003543041.1| PREDICTED: eukaryotic translation initiation factor 3 subunit D-like isoform X1 [Glycine max] gi|571500121|ref|XP_006594590.1| PREDICTED: eukaryotic translation initiation factor 3 subunit D-like isoform X2 [Glycine max] Length = 557 Score = 129 bits (325), Expect = 3e-28 Identities = 61/68 (89%), Positives = 65/68 (95%) Frame = +3 Query: 3 LLLCGGLESYDRSYDRVTPNNERRLERFKNRNFFKVTTTDDPVIRRLANEDKATVFATDS 182 LLLCG LE YDR+YDR+TP NERRLERFKNRNFFKVTTTDDP+IRRLANEDKATVFATD+ Sbjct: 183 LLLCGALEYYDRTYDRITPKNERRLERFKNRNFFKVTTTDDPIIRRLANEDKATVFATDT 242 Query: 183 ILSTLMCA 206 ILSTLMCA Sbjct: 243 ILSTLMCA 250 >ref|XP_004485789.1| PREDICTED: eukaryotic translation initiation factor 3 subunit D-like [Cicer arietinum] Length = 561 Score = 129 bits (324), Expect = 4e-28 Identities = 61/68 (89%), Positives = 65/68 (95%) Frame = +3 Query: 3 LLLCGGLESYDRSYDRVTPNNERRLERFKNRNFFKVTTTDDPVIRRLANEDKATVFATDS 182 LL CG LE+YDRS+DR+TP NERRLERFKNRNFFKVTTTDDPVIRRLANEDKATVFATD+ Sbjct: 184 LLFCGALENYDRSFDRITPKNERRLERFKNRNFFKVTTTDDPVIRRLANEDKATVFATDT 243 Query: 183 ILSTLMCA 206 ILSTLMCA Sbjct: 244 ILSTLMCA 251 >ref|XP_007025596.1| Eukaryotic translation initiation factor 3 subunit 7 (eIF-3) isoform 1 [Theobroma cacao] gi|590624417|ref|XP_007025597.1| Eukaryotic translation initiation factor 3 subunit 7 (eIF-3) isoform 1 [Theobroma cacao] gi|590624420|ref|XP_007025598.1| Eukaryotic translation initiation factor 3 subunit 7 (eIF-3) isoform 1 [Theobroma cacao] gi|508780962|gb|EOY28218.1| Eukaryotic translation initiation factor 3 subunit 7 (eIF-3) isoform 1 [Theobroma cacao] gi|508780963|gb|EOY28219.1| Eukaryotic translation initiation factor 3 subunit 7 (eIF-3) isoform 1 [Theobroma cacao] gi|508780964|gb|EOY28220.1| Eukaryotic translation initiation factor 3 subunit 7 (eIF-3) isoform 1 [Theobroma cacao] Length = 580 Score = 128 bits (322), Expect = 7e-28 Identities = 61/68 (89%), Positives = 65/68 (95%) Frame = +3 Query: 3 LLLCGGLESYDRSYDRVTPNNERRLERFKNRNFFKVTTTDDPVIRRLANEDKATVFATDS 182 LLLCG LE YDRS+DR+TP NERRLERFKNRNFFKVTTTDDPVIRRLANEDKATVFATD+ Sbjct: 206 LLLCGALEYYDRSFDRITPKNERRLERFKNRNFFKVTTTDDPVIRRLANEDKATVFATDT 265 Query: 183 ILSTLMCA 206 IL+TLMCA Sbjct: 266 ILATLMCA 273 >ref|XP_006467784.1| PREDICTED: eukaryotic translation initiation factor 3 subunit D-like isoform X1 [Citrus sinensis] gi|568826858|ref|XP_006467785.1| PREDICTED: eukaryotic translation initiation factor 3 subunit D-like isoform X2 [Citrus sinensis] gi|568826860|ref|XP_006467786.1| PREDICTED: eukaryotic translation initiation factor 3 subunit D-like isoform X3 [Citrus sinensis] Length = 573 Score = 127 bits (319), Expect = 2e-27 Identities = 62/68 (91%), Positives = 64/68 (94%) Frame = +3 Query: 3 LLLCGGLESYDRSYDRVTPNNERRLERFKNRNFFKVTTTDDPVIRRLANEDKATVFATDS 182 LLLCG LE YDRSYDRVTP NERRLERFK RNFFKVTTTDDPVIRRLANEDKATVFATD+ Sbjct: 199 LLLCGSLEYYDRSYDRVTPKNERRLERFKYRNFFKVTTTDDPVIRRLANEDKATVFATDA 258 Query: 183 ILSTLMCA 206 IL+TLMCA Sbjct: 259 ILATLMCA 266 >ref|XP_006449357.1| hypothetical protein CICLE_v10017475mg [Citrus clementina] gi|557551968|gb|ESR62597.1| hypothetical protein CICLE_v10017475mg [Citrus clementina] Length = 573 Score = 127 bits (319), Expect = 2e-27 Identities = 62/68 (91%), Positives = 64/68 (94%) Frame = +3 Query: 3 LLLCGGLESYDRSYDRVTPNNERRLERFKNRNFFKVTTTDDPVIRRLANEDKATVFATDS 182 LLLCG LE YDRSYDRVTP NERRLERFK RNFFKVTTTDDPVIRRLANEDKATVFATD+ Sbjct: 199 LLLCGSLEYYDRSYDRVTPKNERRLERFKYRNFFKVTTTDDPVIRRLANEDKATVFATDA 258 Query: 183 ILSTLMCA 206 IL+TLMCA Sbjct: 259 ILATLMCA 266 >gb|EYU27980.1| hypothetical protein MIMGU_mgv1a003522mg [Mimulus guttatus] Length = 580 Score = 126 bits (317), Expect = 3e-27 Identities = 61/68 (89%), Positives = 64/68 (94%) Frame = +3 Query: 3 LLLCGGLESYDRSYDRVTPNNERRLERFKNRNFFKVTTTDDPVIRRLANEDKATVFATDS 182 LL+CGGLE YDR+YDR+TP N R LERFKNRNFFKVTTTDDPVIRRLANEDKATVFATDS Sbjct: 205 LLICGGLEFYDRAYDRITPKNCRPLERFKNRNFFKVTTTDDPVIRRLANEDKATVFATDS 264 Query: 183 ILSTLMCA 206 ILSTLMCA Sbjct: 265 ILSTLMCA 272 >gb|EXB30288.1| Eukaryotic translation initiation factor 3 subunit D [Morus notabilis] Length = 725 Score = 125 bits (315), Expect = 5e-27 Identities = 60/68 (88%), Positives = 64/68 (94%) Frame = +3 Query: 3 LLLCGGLESYDRSYDRVTPNNERRLERFKNRNFFKVTTTDDPVIRRLANEDKATVFATDS 182 LLLCGGLE YDR++DR+TP NERRLERFKNRNFFKVTTTDDPVIRRLANEDKAT ATD+ Sbjct: 191 LLLCGGLEFYDRAFDRITPKNERRLERFKNRNFFKVTTTDDPVIRRLANEDKATGLATDT 250 Query: 183 ILSTLMCA 206 ILSTLMCA Sbjct: 251 ILSTLMCA 258 Score = 121 bits (303), Expect = 1e-25 Identities = 58/67 (86%), Positives = 62/67 (92%) Frame = +3 Query: 6 LLCGGLESYDRSYDRVTPNNERRLERFKNRNFFKVTTTDDPVIRRLANEDKATVFATDSI 185 LLCGGL YD ++DR+TP NERRLERFKNRNFFKVTTTDDPVIRRLANEDKATVFA D+I Sbjct: 379 LLCGGLGFYDCAFDRITPKNERRLERFKNRNFFKVTTTDDPVIRRLANEDKATVFAIDAI 438 Query: 186 LSTLMCA 206 LSTLMCA Sbjct: 439 LSTLMCA 445 >ref|XP_002305792.2| hypothetical protein POPTR_0004s044402g, partial [Populus trichocarpa] gi|550340310|gb|EEE86303.2| hypothetical protein POPTR_0004s044402g, partial [Populus trichocarpa] Length = 355 Score = 125 bits (315), Expect = 5e-27 Identities = 59/68 (86%), Positives = 65/68 (95%) Frame = +3 Query: 3 LLLCGGLESYDRSYDRVTPNNERRLERFKNRNFFKVTTTDDPVIRRLANEDKATVFATDS 182 L+LCGGLE YD+S+DR+TP ERRLERFKNRNFFKVTTTDDPVIRRLANEDKATVFATD+ Sbjct: 198 LILCGGLEFYDKSFDRITPKAERRLERFKNRNFFKVTTTDDPVIRRLANEDKATVFATDN 257 Query: 183 ILSTLMCA 206 IL+TLMCA Sbjct: 258 ILATLMCA 265 >ref|XP_006377371.1| Eukaryotic translation initiation factor 3 subunit 7 family protein [Populus trichocarpa] gi|550327660|gb|ERP55168.1| Eukaryotic translation initiation factor 3 subunit 7 family protein [Populus trichocarpa] Length = 574 Score = 125 bits (313), Expect = 8e-27 Identities = 58/68 (85%), Positives = 65/68 (95%) Frame = +3 Query: 3 LLLCGGLESYDRSYDRVTPNNERRLERFKNRNFFKVTTTDDPVIRRLANEDKATVFATDS 182 ++LCGGLE YD+S+DR+TP ERRLERFKNRNFFKVTTTDDPVIRRLANEDKATVFATD+ Sbjct: 200 MILCGGLEFYDKSFDRITPKAERRLERFKNRNFFKVTTTDDPVIRRLANEDKATVFATDN 259 Query: 183 ILSTLMCA 206 IL+TLMCA Sbjct: 260 ILATLMCA 267 >gb|EPS68309.1| hypothetical protein M569_06452, partial [Genlisea aurea] Length = 570 Score = 124 bits (312), Expect = 1e-26 Identities = 60/68 (88%), Positives = 64/68 (94%) Frame = +3 Query: 3 LLLCGGLESYDRSYDRVTPNNERRLERFKNRNFFKVTTTDDPVIRRLANEDKATVFATDS 182 LL+CGGLE YDRSYDR+TP N R LERFK+RNFFKVTTTDDPVIRRLANEDKATVFATD+ Sbjct: 205 LLICGGLEFYDRSYDRITPKNCRPLERFKSRNFFKVTTTDDPVIRRLANEDKATVFATDT 264 Query: 183 ILSTLMCA 206 ILSTLMCA Sbjct: 265 ILSTLMCA 272 >gb|EYU43387.1| hypothetical protein MIMGU_mgv1a003500mg [Mimulus guttatus] Length = 581 Score = 124 bits (310), Expect = 2e-26 Identities = 59/68 (86%), Positives = 64/68 (94%) Frame = +3 Query: 3 LLLCGGLESYDRSYDRVTPNNERRLERFKNRNFFKVTTTDDPVIRRLANEDKATVFATDS 182 +L+CGGLE YDRSYDR+TP N R LERFK+RNFFKVTTTDDPVIRRLANEDKATVFATD+ Sbjct: 204 MLICGGLEFYDRSYDRITPKNCRPLERFKSRNFFKVTTTDDPVIRRLANEDKATVFATDA 263 Query: 183 ILSTLMCA 206 ILSTLMCA Sbjct: 264 ILSTLMCA 271