BLASTX nr result
ID: Paeonia24_contig00001725
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00001725 (334 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002320996.1| hypothetical protein POPTR_0014s12090g [Popu... 60 3e-07 ref|XP_002301490.2| hypothetical protein POPTR_0002s20270g [Popu... 58 1e-06 gb|ACM49846.1| ethylene responsive transcription factor 2b [Prun... 57 3e-06 >ref|XP_002320996.1| hypothetical protein POPTR_0014s12090g [Populus trichocarpa] gi|222861769|gb|EEE99311.1| hypothetical protein POPTR_0014s12090g [Populus trichocarpa] Length = 309 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/50 (60%), Positives = 39/50 (78%), Gaps = 2/50 (4%) Frame = +1 Query: 190 MCGGAVLADLIP-RNRRVSASDLWPDSSFAKTS-FESYPSRVSNEDSFTL 333 MCGGA+LA LIP R RV+AS+ WP+SSF K S F++YPS + N++ FTL Sbjct: 1 MCGGAILAGLIPHRGHRVAASEFWPNSSFNKPSPFDTYPSPLRNQEPFTL 50 >ref|XP_002301490.2| hypothetical protein POPTR_0002s20270g [Populus trichocarpa] gi|550345447|gb|EEE80763.2| hypothetical protein POPTR_0002s20270g [Populus trichocarpa] Length = 313 Score = 58.2 bits (139), Expect = 1e-06 Identities = 31/51 (60%), Positives = 38/51 (74%), Gaps = 3/51 (5%) Frame = +1 Query: 190 MCGGAVLADLIPRN--RRVSASDLWPDSSFAKTS-FESYPSRVSNEDSFTL 333 MCGGA+LAD+IPRN RR +AS WP+S F K FES S+ SN++SFTL Sbjct: 1 MCGGAILADIIPRNRGRREAASQFWPNSCFDKLGPFESCLSQPSNQESFTL 51 >gb|ACM49846.1| ethylene responsive transcription factor 2b [Prunus salicina] Length = 327 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/51 (56%), Positives = 38/51 (74%), Gaps = 6/51 (11%) Frame = +1 Query: 190 MCGGAVLADLIPRNR--RVSASDLWPDSSFAKTS----FESYPSRVSNEDS 324 MCGGA+L++LIPRNR RV+ASD+WP+S FAK F+S PS ++ DS Sbjct: 1 MCGGAILSNLIPRNRGLRVTASDIWPNSPFAKLDPDNFFDSNPSSLTRTDS 51