BLASTX nr result
ID: Paeonia23_contig00045487
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00045487 (283 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004301025.1| PREDICTED: pentatricopeptide repeat-containi... 87 2e-15 ref|XP_006848936.1| hypothetical protein AMTR_s00166p00033330 [A... 65 1e-08 ref|XP_004287591.1| PREDICTED: pentatricopeptide repeat-containi... 59 9e-07 ref|XP_007201718.1| hypothetical protein PRUPE_ppa003482mg [Prun... 58 2e-06 ref|XP_007029178.1| Pentatricopeptide repeat (PPR) superfamily p... 57 2e-06 ref|XP_004150015.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 gb|EAY77444.1| hypothetical protein OsI_05438 [Oryza sativa Indi... 57 3e-06 gb|EAZ15030.1| hypothetical protein OsJ_04972 [Oryza sativa Japo... 57 3e-06 ref|XP_007027438.1| Tetratricopeptide repeat-like superfamily pr... 56 6e-06 emb|CBI39100.3| unnamed protein product [Vitis vinifera] 56 6e-06 ref|XP_002267596.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 ref|XP_007014360.1| Pentatricopeptide repeat superfamily protein... 55 8e-06 ref|XP_007014358.1| Pentatricopeptide repeat superfamily protein... 55 8e-06 ref|XP_007014357.1| Pentatricopeptide repeat superfamily protein... 55 8e-06 >ref|XP_004301025.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Fragaria vesca subsp. vesca] Length = 568 Score = 87.0 bits (214), Expect = 2e-15 Identities = 40/65 (61%), Positives = 48/65 (73%) Frame = +2 Query: 77 SFPTYARLIFSSFPYPNLSLFNHTIRAFSKNPSLCAESLHFYVRMVHSQIRPDNFTYPFL 256 S P + +F+SFP PNLSLFNH IRAFSK PSL + + Y +MV IRPDN+TYPF+ Sbjct: 63 SSPNHTHRVFTSFPNPNLSLFNHAIRAFSKTPSLSSHATALYRQMVRVGIRPDNYTYPFV 122 Query: 257 LNSCA 271 LNSCA Sbjct: 123 LNSCA 127 >ref|XP_006848936.1| hypothetical protein AMTR_s00166p00033330 [Amborella trichopoda] gi|548852397|gb|ERN10517.1| hypothetical protein AMTR_s00166p00033330 [Amborella trichopoda] Length = 240 Score = 65.1 bits (157), Expect = 1e-08 Identities = 33/64 (51%), Positives = 44/64 (68%), Gaps = 1/64 (1%) Frame = +2 Query: 89 YARLIFSSFPYPNLSLFNHTIRAFSKNPSLCAESLHFYVRMVHSQ-IRPDNFTYPFLLNS 265 YA L+F P+PNLSL+N I+ KN SL ++L FY M + ++P+NFT+PFLLNS Sbjct: 57 YAHLVFHCVPHPNLSLWNELIKTHVKN-SLHTQALSFYAAMTATTPLKPNNFTFPFLLNS 115 Query: 266 CATL 277 CA L Sbjct: 116 CAAL 119 >ref|XP_004287591.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09190-like [Fragaria vesca subsp. vesca] Length = 487 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/64 (43%), Positives = 38/64 (59%) Frame = +2 Query: 89 YARLIFSSFPYPNLSLFNHTIRAFSKNPSLCAESLHFYVRMVHSQIRPDNFTYPFLLNSC 268 YA LIF +PN+ LFN I++FS +P SL + M +I PD FT+P LL SC Sbjct: 59 YAHLIFQQTHHPNILLFNSLIKSFSLSPPSSHSSLLIFSHMKRRRICPDEFTFPPLLKSC 118 Query: 269 ATLC 280 + +C Sbjct: 119 SNIC 122 >ref|XP_007201718.1| hypothetical protein PRUPE_ppa003482mg [Prunus persica] gi|462397118|gb|EMJ02917.1| hypothetical protein PRUPE_ppa003482mg [Prunus persica] Length = 571 Score = 57.8 bits (138), Expect = 2e-06 Identities = 32/67 (47%), Positives = 38/67 (56%), Gaps = 3/67 (4%) Frame = +2 Query: 86 TYARLIFSSFPYPNLSLFNHTIRAFSKNPSLCAESLHFYVRM---VHSQIRPDNFTYPFL 256 +YARLI SFP PN +N IRA+S++ L F + H RPD FTYPFL Sbjct: 43 SYARLILDSFPAPNSYYYNTMIRAYSQSSDPIQALLLFLPMLEDPTHHTPRPDKFTYPFL 102 Query: 257 LNSCATL 277 L SCA L Sbjct: 103 LKSCARL 109 >ref|XP_007029178.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] gi|508717783|gb|EOY09680.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 626 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/65 (44%), Positives = 41/65 (63%), Gaps = 2/65 (3%) Frame = +2 Query: 89 YARLIFSSFPYPNLSLFNHTIRAFS--KNPSLCAESLHFYVRMVHSQIRPDNFTYPFLLN 262 YA IFS PNL +FN I+ FS +NP +S HFY +++ + I PDN ++PFL+ Sbjct: 74 YAFKIFSQIETPNLFIFNALIKGFSACQNPH---QSFHFYTQLLRANILPDNLSFPFLVR 130 Query: 263 SCATL 277 +CA L Sbjct: 131 ACAQL 135 >ref|XP_004150015.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Cucumis sativus] gi|449529868|ref|XP_004171920.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Cucumis sativus] Length = 734 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/64 (45%), Positives = 44/64 (68%) Frame = +2 Query: 86 TYARLIFSSFPYPNLSLFNHTIRAFSKNPSLCAESLHFYVRMVHSQIRPDNFTYPFLLNS 265 +YA +F+S PNL ++N IR S + S A +L F+VRM++S + P+++T+PFLL S Sbjct: 80 SYAISLFNSIEEPNLFIWNSMIRGLSMSLSP-ALALVFFVRMIYSGVEPNSYTFPFLLKS 138 Query: 266 CATL 277 CA L Sbjct: 139 CAKL 142 >gb|EAY77444.1| hypothetical protein OsI_05438 [Oryza sativa Indica Group] Length = 813 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/63 (38%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +2 Query: 92 ARLIFSSFPYPNLSLFNHTIRAFSKN-PSLCAESLHFYVRMVHSQIRPDNFTYPFLLNSC 268 A +F P P++ +N IRA+S + P+ A+ LH Y RM+ ++ P+N+T+PF L +C Sbjct: 76 AHHLFDQIPSPDVRTYNDLIRAYSSSSPTAAADGLHLYRRMLRHRVAPNNYTFPFALKAC 135 Query: 269 ATL 277 + L Sbjct: 136 SAL 138 >gb|EAZ15030.1| hypothetical protein OsJ_04972 [Oryza sativa Japonica Group] Length = 813 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/63 (38%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +2 Query: 92 ARLIFSSFPYPNLSLFNHTIRAFSKN-PSLCAESLHFYVRMVHSQIRPDNFTYPFLLNSC 268 A +F P P++ +N IRA+S + P+ A+ LH Y RM+ ++ P+N+T+PF L +C Sbjct: 76 AHHLFDQIPSPDVRTYNDLIRAYSSSSPTAAADGLHLYRRMLRHRVAPNNYTFPFALKAC 135 Query: 269 ATL 277 + L Sbjct: 136 SAL 138 >ref|XP_007027438.1| Tetratricopeptide repeat-like superfamily protein, putative [Theobroma cacao] gi|508716043|gb|EOY07940.1| Tetratricopeptide repeat-like superfamily protein, putative [Theobroma cacao] Length = 756 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/64 (43%), Positives = 42/64 (65%), Gaps = 1/64 (1%) Frame = +2 Query: 89 YARLIFSSFPYPNLSLFNHTIRAFSKNPSLCAESLHFYVRMVHSQIRP-DNFTYPFLLNS 265 Y++++F +PN ++N IR FS + ++L FY M+H + RP +NFT+PFLLNS Sbjct: 97 YSQILFCQIEHPNQFMYNTMIRGFSHS-EFPEKALIFYSSMLHQENRPPNNFTFPFLLNS 155 Query: 266 CATL 277 CA L Sbjct: 156 CARL 159 >emb|CBI39100.3| unnamed protein product [Vitis vinifera] Length = 483 Score = 55.8 bits (133), Expect = 6e-06 Identities = 30/65 (46%), Positives = 37/65 (56%), Gaps = 2/65 (3%) Frame = +2 Query: 89 YARLIFSSFPYPNLSLFNHTIRAFS--KNPSLCAESLHFYVRMVHSQIRPDNFTYPFLLN 262 YA IFS PNL +FN IR S KNP ++ HFYV+ + PDN T+PFL+ Sbjct: 19 YASRIFSQIQNPNLFIFNAMIRGHSGSKNPD---QAFHFYVQSQRQGLLPDNLTFPFLVK 75 Query: 263 SCATL 277 SC L Sbjct: 76 SCTKL 80 >ref|XP_002267596.1| PREDICTED: pentatricopeptide repeat-containing protein At5g06540-like [Vitis vinifera] Length = 623 Score = 55.8 bits (133), Expect = 6e-06 Identities = 30/65 (46%), Positives = 37/65 (56%), Gaps = 2/65 (3%) Frame = +2 Query: 89 YARLIFSSFPYPNLSLFNHTIRAFS--KNPSLCAESLHFYVRMVHSQIRPDNFTYPFLLN 262 YA IFS PNL +FN IR S KNP ++ HFYV+ + PDN T+PFL+ Sbjct: 71 YASRIFSQIQNPNLFIFNAMIRGHSGSKNPD---QAFHFYVQSQRQGLLPDNLTFPFLVK 127 Query: 263 SCATL 277 SC L Sbjct: 128 SCTKL 132 >ref|XP_007014360.1| Pentatricopeptide repeat superfamily protein isoform 4 [Theobroma cacao] gi|590581496|ref|XP_007014363.1| Pentatricopeptide repeat superfamily protein isoform 4 [Theobroma cacao] gi|508784723|gb|EOY31979.1| Pentatricopeptide repeat superfamily protein isoform 4 [Theobroma cacao] gi|508784726|gb|EOY31982.1| Pentatricopeptide repeat superfamily protein isoform 4 [Theobroma cacao] Length = 619 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/63 (42%), Positives = 36/63 (57%) Frame = +2 Query: 89 YARLIFSSFPYPNLSLFNHTIRAFSKNPSLCAESLHFYVRMVHSQIRPDNFTYPFLLNSC 268 YA L+FS P PN FN IR + + +LHFY +M ++P+ FTYPFL +C Sbjct: 78 YASLLFSQIPQPNDYAFNVMIRGLTTTWQHYSTTLHFYYQMKFLGLKPNKFTYPFLFIAC 137 Query: 269 ATL 277 A L Sbjct: 138 ANL 140 >ref|XP_007014358.1| Pentatricopeptide repeat superfamily protein isoform 2 [Theobroma cacao] gi|590581482|ref|XP_007014359.1| Pentatricopeptide repeat superfamily protein isoform 2 [Theobroma cacao] gi|590581490|ref|XP_007014361.1| Pentatricopeptide repeat superfamily protein isoform 2 [Theobroma cacao] gi|590581493|ref|XP_007014362.1| Pentatricopeptide repeat superfamily protein isoform 2 [Theobroma cacao] gi|508784721|gb|EOY31977.1| Pentatricopeptide repeat superfamily protein isoform 2 [Theobroma cacao] gi|508784722|gb|EOY31978.1| Pentatricopeptide repeat superfamily protein isoform 2 [Theobroma cacao] gi|508784724|gb|EOY31980.1| Pentatricopeptide repeat superfamily protein isoform 2 [Theobroma cacao] gi|508784725|gb|EOY31981.1| Pentatricopeptide repeat superfamily protein isoform 2 [Theobroma cacao] Length = 565 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/63 (42%), Positives = 36/63 (57%) Frame = +2 Query: 89 YARLIFSSFPYPNLSLFNHTIRAFSKNPSLCAESLHFYVRMVHSQIRPDNFTYPFLLNSC 268 YA L+FS P PN FN IR + + +LHFY +M ++P+ FTYPFL +C Sbjct: 24 YASLLFSQIPQPNDYAFNVMIRGLTTTWQHYSTTLHFYYQMKFLGLKPNKFTYPFLFIAC 83 Query: 269 ATL 277 A L Sbjct: 84 ANL 86 >ref|XP_007014357.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] gi|508784720|gb|EOY31976.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] Length = 656 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/63 (42%), Positives = 36/63 (57%) Frame = +2 Query: 89 YARLIFSSFPYPNLSLFNHTIRAFSKNPSLCAESLHFYVRMVHSQIRPDNFTYPFLLNSC 268 YA L+FS P PN FN IR + + +LHFY +M ++P+ FTYPFL +C Sbjct: 115 YASLLFSQIPQPNDYAFNVMIRGLTTTWQHYSTTLHFYYQMKFLGLKPNKFTYPFLFIAC 174 Query: 269 ATL 277 A L Sbjct: 175 ANL 177