BLASTX nr result
ID: Paeonia23_contig00045287
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00045287 (234 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002884065.1| hypothetical protein ARALYDRAFT_343373 [Arab... 126 4e-27 ref|XP_006409291.1| hypothetical protein EUTSA_v10022597mg [Eutr... 125 8e-27 ref|NP_671862.1| pentatricopeptide repeat-containing protein [Ar... 124 1e-26 gb|AAO72718.1| pentatricopeptide repeat-containing protein [Arab... 124 1e-26 ref|XP_002521729.1| pentatricopeptide repeat-containing protein,... 124 1e-26 ref|XP_002307219.2| hypothetical protein POPTR_0005s10540g [Popu... 123 2e-26 ref|XP_006297198.1| hypothetical protein CARUB_v10013206mg [Caps... 123 2e-26 ref|XP_007046481.1| Pentatricopeptide repeat-containing protein,... 123 3e-26 ref|XP_004308566.1| PREDICTED: pentatricopeptide repeat-containi... 119 6e-25 ref|XP_006467094.1| PREDICTED: pentatricopeptide repeat-containi... 118 8e-25 ref|XP_006425269.1| hypothetical protein CICLE_v10026953mg [Citr... 118 8e-25 ref|XP_002274224.2| PREDICTED: pentatricopeptide repeat-containi... 117 1e-24 emb|CBI30973.3| unnamed protein product [Vitis vinifera] 117 1e-24 ref|XP_007158017.1| hypothetical protein PHAVU_002G117300g [Phas... 116 3e-24 ref|XP_003612374.1| Pentatricopeptide repeat-containing protein ... 116 3e-24 ref|XP_004512279.1| PREDICTED: pentatricopeptide repeat-containi... 116 4e-24 ref|XP_007219485.1| hypothetical protein PRUPE_ppa022097mg, part... 116 4e-24 ref|XP_006573520.1| PREDICTED: pentatricopeptide repeat-containi... 114 1e-23 ref|XP_003516519.1| PREDICTED: pentatricopeptide repeat-containi... 114 1e-23 ref|XP_006350309.1| PREDICTED: pentatricopeptide repeat-containi... 111 9e-23 >ref|XP_002884065.1| hypothetical protein ARALYDRAFT_343373 [Arabidopsis lyrata subsp. lyrata] gi|297329905|gb|EFH60324.1| hypothetical protein ARALYDRAFT_343373 [Arabidopsis lyrata subsp. lyrata] Length = 1056 Score = 126 bits (316), Expect = 4e-27 Identities = 61/78 (78%), Positives = 72/78 (92%) Frame = -1 Query: 234 EMSEPNEVTFNILISAYCREENLIQALVLLEKSFNLGLVPDIVTVTKVLELLCNEDRVTE 55 EM EPN+VTFNILISAYC E+ LIQ++VLLEK F+LGLVPD+VTVTKV+E+LCNE RV+E Sbjct: 230 EMKEPNDVTFNILISAYCNEQKLIQSMVLLEKCFSLGLVPDVVTVTKVMEVLCNEGRVSE 289 Query: 54 AVEVLERVESKGGGVDVL 1 A+EVLERVESKGG VDV+ Sbjct: 290 ALEVLERVESKGGKVDVV 307 >ref|XP_006409291.1| hypothetical protein EUTSA_v10022597mg [Eutrema salsugineum] gi|557110453|gb|ESQ50744.1| hypothetical protein EUTSA_v10022597mg [Eutrema salsugineum] Length = 629 Score = 125 bits (313), Expect = 8e-27 Identities = 59/78 (75%), Positives = 72/78 (92%) Frame = -1 Query: 234 EMSEPNEVTFNILISAYCREENLIQALVLLEKSFNLGLVPDIVTVTKVLELLCNEDRVTE 55 EM EPN+VTFNILISAYC E+ L+Q+LVLLEK F+LGLVPD+VTVTKV+++LCNE RV+E Sbjct: 245 EMKEPNDVTFNILISAYCNEQKLVQSLVLLEKCFSLGLVPDVVTVTKVMDVLCNEGRVSE 304 Query: 54 AVEVLERVESKGGGVDVL 1 A+EVLERVESKGG VD++ Sbjct: 305 ALEVLERVESKGGKVDIV 322 >ref|NP_671862.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|218546776|sp|Q84VG6.2|PP160_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g17525, mitochondrial; Flags: Precursor gi|330251547|gb|AEC06641.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 626 Score = 124 bits (312), Expect = 1e-26 Identities = 60/78 (76%), Positives = 71/78 (91%) Frame = -1 Query: 234 EMSEPNEVTFNILISAYCREENLIQALVLLEKSFNLGLVPDIVTVTKVLELLCNEDRVTE 55 EM EPN+VTFNILISAYC E+ LIQ++VLLEK F+LG VPD+VTVTKV+E+LCNE RV+E Sbjct: 242 EMKEPNDVTFNILISAYCNEQKLIQSMVLLEKCFSLGFVPDVVTVTKVMEVLCNEGRVSE 301 Query: 54 AVEVLERVESKGGGVDVL 1 A+EVLERVESKGG VDV+ Sbjct: 302 ALEVLERVESKGGKVDVV 319 >gb|AAO72718.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 532 Score = 124 bits (312), Expect = 1e-26 Identities = 60/78 (76%), Positives = 71/78 (91%) Frame = -1 Query: 234 EMSEPNEVTFNILISAYCREENLIQALVLLEKSFNLGLVPDIVTVTKVLELLCNEDRVTE 55 EM EPN+VTFNILISAYC E+ LIQ++VLLEK F+LG VPD+VTVTKV+E+LCNE RV+E Sbjct: 141 EMKEPNDVTFNILISAYCNEQKLIQSMVLLEKCFSLGFVPDVVTVTKVMEVLCNEGRVSE 200 Query: 54 AVEVLERVESKGGGVDVL 1 A+EVLERVESKGG VDV+ Sbjct: 201 ALEVLERVESKGGKVDVV 218 >ref|XP_002521729.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223539120|gb|EEF40716.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 629 Score = 124 bits (311), Expect = 1e-26 Identities = 59/78 (75%), Positives = 72/78 (92%) Frame = -1 Query: 234 EMSEPNEVTFNILISAYCREENLIQALVLLEKSFNLGLVPDIVTVTKVLELLCNEDRVTE 55 E+ EPN+VTFN+LI+AYC+EENL+QALVLLEKSF+LG VPD+VT+TKV+E+LCN RVTE Sbjct: 238 EIEEPNDVTFNVLIAAYCKEENLVQALVLLEKSFSLGFVPDVVTMTKVVEILCNAGRVTE 297 Query: 54 AVEVLERVESKGGGVDVL 1 AVE+LERVE KGG VDV+ Sbjct: 298 AVEMLERVEYKGGLVDVV 315 >ref|XP_002307219.2| hypothetical protein POPTR_0005s10540g [Populus trichocarpa] gi|550338572|gb|EEE94215.2| hypothetical protein POPTR_0005s10540g [Populus trichocarpa] Length = 532 Score = 123 bits (309), Expect = 2e-26 Identities = 58/78 (74%), Positives = 70/78 (89%) Frame = -1 Query: 234 EMSEPNEVTFNILISAYCREENLIQALVLLEKSFNLGLVPDIVTVTKVLELLCNEDRVTE 55 E+ EPN+VTFN+LI YC+E+N +QALVLLEKSF+LG VPD+VTVTKV+E+LCN RVTE Sbjct: 141 EIKEPNDVTFNVLICGYCKEDNFVQALVLLEKSFSLGFVPDVVTVTKVVEILCNVGRVTE 200 Query: 54 AVEVLERVESKGGGVDVL 1 AVE+LERVESKGG VDV+ Sbjct: 201 AVEILERVESKGGVVDVV 218 >ref|XP_006297198.1| hypothetical protein CARUB_v10013206mg [Capsella rubella] gi|482565907|gb|EOA30096.1| hypothetical protein CARUB_v10013206mg [Capsella rubella] Length = 629 Score = 123 bits (309), Expect = 2e-26 Identities = 59/78 (75%), Positives = 72/78 (92%) Frame = -1 Query: 234 EMSEPNEVTFNILISAYCREENLIQALVLLEKSFNLGLVPDIVTVTKVLELLCNEDRVTE 55 E+ EPN+VTFNILISAYC E+ LIQ++VLLEK F+LGLVPD+VTVTKV+E+LCNE RV+E Sbjct: 245 EVKEPNDVTFNILISAYCNEQKLIQSMVLLEKCFSLGLVPDVVTVTKVMEVLCNEGRVSE 304 Query: 54 AVEVLERVESKGGGVDVL 1 A+EVL+RVESKGG VDV+ Sbjct: 305 ALEVLDRVESKGGKVDVV 322 >ref|XP_007046481.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] gi|508698742|gb|EOX90638.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] Length = 639 Score = 123 bits (308), Expect = 3e-26 Identities = 56/78 (71%), Positives = 71/78 (91%) Frame = -1 Query: 234 EMSEPNEVTFNILISAYCREENLIQALVLLEKSFNLGLVPDIVTVTKVLELLCNEDRVTE 55 EM +PN+VTFN+LISAYC+EENL+QALVL+E+SF +G VPD++T+TKVL++LCN RV E Sbjct: 248 EMQDPNDVTFNVLISAYCKEENLVQALVLVERSFTMGFVPDVITLTKVLKILCNAGRVAE 307 Query: 54 AVEVLERVESKGGGVDVL 1 A+E+LERVESKGG VDVL Sbjct: 308 ALEILERVESKGGVVDVL 325 >ref|XP_004308566.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17525, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 612 Score = 119 bits (297), Expect = 6e-25 Identities = 57/78 (73%), Positives = 68/78 (87%) Frame = -1 Query: 234 EMSEPNEVTFNILISAYCREENLIQALVLLEKSFNLGLVPDIVTVTKVLELLCNEDRVTE 55 EM +PN+VTFNILIS YC EENL+QA+V+L+K F LG VPD+VT+TKVLELLCN+ RV E Sbjct: 221 EMEDPNDVTFNILISGYCGEENLVQAVVMLDKCFGLGYVPDVVTITKVLELLCNDGRVME 280 Query: 54 AVEVLERVESKGGGVDVL 1 AV+VLERVES GG VDV+ Sbjct: 281 AVKVLERVESNGGLVDVV 298 >ref|XP_006467094.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17525, mitochondrial-like [Citrus sinensis] Length = 618 Score = 118 bits (296), Expect = 8e-25 Identities = 55/78 (70%), Positives = 69/78 (88%) Frame = -1 Query: 234 EMSEPNEVTFNILISAYCREENLIQALVLLEKSFNLGLVPDIVTVTKVLELLCNEDRVTE 55 +M EPN+VTF+ILI AYC+EENL+ ALVLLEKSF+ G VPD+VT+TKVLELLC+ RV + Sbjct: 234 DMEEPNDVTFSILICAYCKEENLVNALVLLEKSFSFGFVPDVVTITKVLELLCSVGRVMD 293 Query: 54 AVEVLERVESKGGGVDVL 1 AVE+LERVESKGG +D++ Sbjct: 294 AVEILERVESKGGVIDIV 311 >ref|XP_006425269.1| hypothetical protein CICLE_v10026953mg [Citrus clementina] gi|557527259|gb|ESR38509.1| hypothetical protein CICLE_v10026953mg [Citrus clementina] Length = 621 Score = 118 bits (296), Expect = 8e-25 Identities = 55/78 (70%), Positives = 69/78 (88%) Frame = -1 Query: 234 EMSEPNEVTFNILISAYCREENLIQALVLLEKSFNLGLVPDIVTVTKVLELLCNEDRVTE 55 +M EPN+VTF+ILI AYC+EENL+ ALVLLEKSF+ G VPD+VT+TKVLELLC+ RV + Sbjct: 234 DMEEPNDVTFSILICAYCKEENLVNALVLLEKSFSFGFVPDVVTITKVLELLCSVGRVMD 293 Query: 54 AVEVLERVESKGGGVDVL 1 AVE+LERVESKGG +D++ Sbjct: 294 AVEILERVESKGGVIDIV 311 >ref|XP_002274224.2| PREDICTED: pentatricopeptide repeat-containing protein At2g17525, mitochondrial-like [Vitis vinifera] Length = 686 Score = 117 bits (294), Expect = 1e-24 Identities = 57/78 (73%), Positives = 68/78 (87%) Frame = -1 Query: 234 EMSEPNEVTFNILISAYCREENLIQALVLLEKSFNLGLVPDIVTVTKVLELLCNEDRVTE 55 EM EP++VTFN+LISAYC+EENL+QALVLLEKSF++G VPD+VT TKV+ +LC RVTE Sbjct: 293 EMVEPSDVTFNVLISAYCQEENLVQALVLLEKSFSMGFVPDVVTATKVVGILCKAGRVTE 352 Query: 54 AVEVLERVESKGGGVDVL 1 VEVLERVES GG VDV+ Sbjct: 353 GVEVLERVESMGGVVDVV 370 >emb|CBI30973.3| unnamed protein product [Vitis vinifera] Length = 722 Score = 117 bits (294), Expect = 1e-24 Identities = 57/78 (73%), Positives = 68/78 (87%) Frame = -1 Query: 234 EMSEPNEVTFNILISAYCREENLIQALVLLEKSFNLGLVPDIVTVTKVLELLCNEDRVTE 55 EM EP++VTFN+LISAYC+EENL+QALVLLEKSF++G VPD+VT TKV+ +LC RVTE Sbjct: 141 EMVEPSDVTFNVLISAYCQEENLVQALVLLEKSFSMGFVPDVVTATKVVGILCKAGRVTE 200 Query: 54 AVEVLERVESKGGGVDVL 1 VEVLERVES GG VDV+ Sbjct: 201 GVEVLERVESMGGVVDVV 218 >ref|XP_007158017.1| hypothetical protein PHAVU_002G117300g [Phaseolus vulgaris] gi|561031432|gb|ESW30011.1| hypothetical protein PHAVU_002G117300g [Phaseolus vulgaris] Length = 626 Score = 116 bits (291), Expect = 3e-24 Identities = 57/78 (73%), Positives = 65/78 (83%) Frame = -1 Query: 234 EMSEPNEVTFNILISAYCREENLIQALVLLEKSFNLGLVPDIVTVTKVLELLCNEDRVTE 55 EM EPN+VTFNILIS YC+E N +Q LVLLEKSF+LG VPD V+VTKVLE+LCN R TE Sbjct: 243 EMEEPNDVTFNILISGYCKEGNSVQPLVLLEKSFSLGFVPDTVSVTKVLEILCNAGRATE 302 Query: 54 AVEVLERVESKGGGVDVL 1 A EVLERVES GG +DV+ Sbjct: 303 AAEVLERVESMGGSLDVV 320 >ref|XP_003612374.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355513709|gb|AES95332.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 620 Score = 116 bits (291), Expect = 3e-24 Identities = 58/78 (74%), Positives = 67/78 (85%) Frame = -1 Query: 234 EMSEPNEVTFNILISAYCREENLIQALVLLEKSFNLGLVPDIVTVTKVLELLCNEDRVTE 55 EM +PNEVTFNILIS+Y +EENL+QALVLLEK F L LVPD+VTVTKV+E+LCN RVTE Sbjct: 237 EMVDPNEVTFNILISSYYKEENLVQALVLLEKCFALSLVPDVVTVTKVVEILCNAGRVTE 296 Query: 54 AVEVLERVESKGGGVDVL 1 A EVLERVES GG +D + Sbjct: 297 AAEVLERVESLGGSLDAV 314 >ref|XP_004512279.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17525, mitochondrial-like [Cicer arietinum] Length = 623 Score = 116 bits (290), Expect = 4e-24 Identities = 55/78 (70%), Positives = 67/78 (85%) Frame = -1 Query: 234 EMSEPNEVTFNILISAYCREENLIQALVLLEKSFNLGLVPDIVTVTKVLELLCNEDRVTE 55 EM+ N VT+NILIS YC+EENL+QALVLLEK F +GLVPD++T+TKV+E+LCN RVTE Sbjct: 239 EMANLNNVTYNILISGYCKEENLVQALVLLEKCFAMGLVPDVITITKVVEILCNAGRVTE 298 Query: 54 AVEVLERVESKGGGVDVL 1 A EVLERVES GG +DV+ Sbjct: 299 AAEVLERVESLGGSLDVV 316 >ref|XP_007219485.1| hypothetical protein PRUPE_ppa022097mg, partial [Prunus persica] gi|462415947|gb|EMJ20684.1| hypothetical protein PRUPE_ppa022097mg, partial [Prunus persica] Length = 511 Score = 116 bits (290), Expect = 4e-24 Identities = 57/78 (73%), Positives = 67/78 (85%) Frame = -1 Query: 234 EMSEPNEVTFNILISAYCREENLIQALVLLEKSFNLGLVPDIVTVTKVLELLCNEDRVTE 55 EM PN+VTFN+LIS YC EENL+QALVLLEK F LG VPDIVTVTKVLE+LC++ RV E Sbjct: 141 EMEAPNDVTFNVLISGYCGEENLVQALVLLEKCFGLGFVPDIVTVTKVLEILCSDGRVME 200 Query: 54 AVEVLERVESKGGGVDVL 1 AV+V+ RVE+KGG VDV+ Sbjct: 201 AVKVIGRVENKGGLVDVV 218 >ref|XP_006573520.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17525, mitochondrial-like isoform X2 [Glycine max] Length = 507 Score = 114 bits (285), Expect = 1e-23 Identities = 55/78 (70%), Positives = 66/78 (84%) Frame = -1 Query: 234 EMSEPNEVTFNILISAYCREENLIQALVLLEKSFNLGLVPDIVTVTKVLELLCNEDRVTE 55 EM +PN+VTFNILIS YC+E N +QALVLLEKSF++G VPD+V+VTKVLE+LCN R E Sbjct: 235 EMEDPNDVTFNILISGYCKEGNSVQALVLLEKSFSMGFVPDVVSVTKVLEILCNAGRTME 294 Query: 54 AVEVLERVESKGGGVDVL 1 A EVLERVES GG +DV+ Sbjct: 295 AAEVLERVESMGGLLDVV 312 >ref|XP_003516519.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17525, mitochondrial-like isoform X1 [Glycine max] Length = 618 Score = 114 bits (285), Expect = 1e-23 Identities = 55/78 (70%), Positives = 66/78 (84%) Frame = -1 Query: 234 EMSEPNEVTFNILISAYCREENLIQALVLLEKSFNLGLVPDIVTVTKVLELLCNEDRVTE 55 EM +PN+VTFNILIS YC+E N +QALVLLEKSF++G VPD+V+VTKVLE+LCN R E Sbjct: 235 EMEDPNDVTFNILISGYCKEGNSVQALVLLEKSFSMGFVPDVVSVTKVLEILCNAGRTME 294 Query: 54 AVEVLERVESKGGGVDVL 1 A EVLERVES GG +DV+ Sbjct: 295 AAEVLERVESMGGLLDVV 312 >ref|XP_006350309.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17525, mitochondrial-like [Solanum tuberosum] Length = 622 Score = 111 bits (278), Expect = 9e-23 Identities = 53/78 (67%), Positives = 68/78 (87%) Frame = -1 Query: 234 EMSEPNEVTFNILISAYCREENLIQALVLLEKSFNLGLVPDIVTVTKVLELLCNEDRVTE 55 ++ EP++VTFNILISAYC E +L+QALV+LEKSFN G +PD++TVTKV+ LLCN RV+E Sbjct: 230 DLVEPSDVTFNILISAYCGEGSLVQALVMLEKSFNKGYIPDVITVTKVVGLLCNNGRVSE 289 Query: 54 AVEVLERVESKGGGVDVL 1 AVE+LERVE +GG VDV+ Sbjct: 290 AVELLERVEERGGIVDVV 307