BLASTX nr result
ID: Paeonia23_contig00045233
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00045233 (229 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006339048.1| PREDICTED: pentatricopeptide repeat-containi... 95 9e-18 ref|XP_004249810.1| PREDICTED: pentatricopeptide repeat-containi... 90 3e-16 >ref|XP_006339048.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Solanum tuberosum] Length = 680 Score = 95.1 bits (235), Expect = 9e-18 Identities = 44/61 (72%), Positives = 51/61 (83%) Frame = +3 Query: 45 KQFALSLLKTRDFLKTIKHLKGLHVYLLRTGLHQTSFAVGNFVTHCARLGVMGYATDVFD 224 KQFALSLLK+ + L T+ HLK LHVYLLRTGLH +SFAVGNF+THCA LG+M YA +FD Sbjct: 12 KQFALSLLKSPNKLSTLNHLKSLHVYLLRTGLHHSSFAVGNFITHCASLGLMSYAAQLFD 71 Query: 225 Q 227 Q Sbjct: 72 Q 72 >ref|XP_004249810.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Solanum lycopersicum] Length = 676 Score = 90.1 bits (222), Expect = 3e-16 Identities = 42/59 (71%), Positives = 50/59 (84%) Frame = +3 Query: 51 FALSLLKTRDFLKTIKHLKGLHVYLLRTGLHQTSFAVGNFVTHCARLGVMGYATDVFDQ 227 FALSLLK+ + L T+ HLK LHVYLLRTGLH++SFAVGNF+THCA LG+M YA +FDQ Sbjct: 10 FALSLLKSPNKLSTLNHLKSLHVYLLRTGLHRSSFAVGNFITHCASLGLMSYAALLFDQ 68