BLASTX nr result
ID: Paeonia23_contig00045177
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00045177 (309 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007198902.1| hypothetical protein PRUPE_ppa005316mg [Prun... 96 4e-18 emb|CBI21840.3| unnamed protein product [Vitis vinifera] 92 6e-17 ref|XP_002273904.1| PREDICTED: pentatricopeptide repeat-containi... 92 6e-17 emb|CAN73453.1| hypothetical protein VITISV_024964 [Vitis vinifera] 92 6e-17 ref|XP_004168984.1| PREDICTED: pentatricopeptide repeat-containi... 91 2e-16 ref|XP_004146598.1| PREDICTED: pentatricopeptide repeat-containi... 91 2e-16 ref|XP_002517926.1| pentatricopeptide repeat-containing protein,... 89 5e-16 ref|XP_006376509.1| hypothetical protein POPTR_0013s13650g [Popu... 88 1e-15 ref|XP_007200782.1| hypothetical protein PRUPE_ppa024012mg [Prun... 88 1e-15 ref|XP_006361033.1| PREDICTED: pentatricopeptide repeat-containi... 87 3e-15 gb|EXB79630.1| hypothetical protein L484_011570 [Morus notabilis] 86 4e-15 ref|XP_004168986.1| PREDICTED: pentatricopeptide repeat-containi... 84 3e-14 ref|XP_004146650.1| PREDICTED: pentatricopeptide repeat-containi... 84 3e-14 ref|XP_004155478.1| PREDICTED: pentatricopeptide repeat-containi... 81 2e-13 ref|XP_004136821.1| PREDICTED: pentatricopeptide repeat-containi... 81 2e-13 ref|XP_002531596.1| pentatricopeptide repeat-containing protein,... 80 3e-13 gb|EXC18126.1| hypothetical protein L484_014527 [Morus notabilis] 79 5e-13 ref|XP_002316903.2| hypothetical protein POPTR_0011s12150g [Popu... 79 7e-13 ref|XP_006347050.1| PREDICTED: pentatricopeptide repeat-containi... 79 9e-13 ref|XP_007211848.1| hypothetical protein PRUPE_ppa004720mg [Prun... 79 9e-13 >ref|XP_007198902.1| hypothetical protein PRUPE_ppa005316mg [Prunus persica] gi|462394197|gb|EMJ00101.1| hypothetical protein PRUPE_ppa005316mg [Prunus persica] Length = 467 Score = 96.3 bits (238), Expect = 4e-18 Identities = 51/96 (53%), Positives = 67/96 (69%), Gaps = 2/96 (2%) Frame = -2 Query: 284 LMKLLKSSNPWRSISISRVFM-VFFSSETLTS-SASGVSLRHRILPAGDPKISVVPVLDQ 111 ++KLL SNPW +I V +F+S+E L S S +L HRI AG+P++S+ PVLDQ Sbjct: 1 MIKLL-GSNPWHGNAIFGVLRTLFYSTEALASCSPPFETLYHRISRAGNPRVSIAPVLDQ 59 Query: 110 WIEEGRSVQKHELQRIVKNLRNYKRFKHALEISEWI 3 W+EEGR V K ELQ VK LR Y+R+ HAL+ISEW+ Sbjct: 60 WVEEGRDVNKSELQSFVKMLRKYRRYSHALQISEWM 95 >emb|CBI21840.3| unnamed protein product [Vitis vinifera] Length = 446 Score = 92.4 bits (228), Expect = 6e-17 Identities = 45/81 (55%), Positives = 63/81 (77%), Gaps = 1/81 (1%) Frame = -2 Query: 242 SISRVFMVF-FSSETLTSSASGVSLRHRILPAGDPKISVVPVLDQWIEEGRSVQKHELQR 66 SISRVF V +S+ETLTS+A SL+ RI PA D ++S+VP L+QW +EGRS+++ +L R Sbjct: 13 SISRVFRVLPYSTETLTSNAPKESLQSRISPAIDLRVSIVPALEQWRKEGRSIKQQDLHR 72 Query: 65 IVKNLRNYKRFKHALEISEWI 3 +++ LR +KR+ HALEI EWI Sbjct: 73 LIRKLRTFKRYNHALEIYEWI 93 >ref|XP_002273904.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial [Vitis vinifera] Length = 499 Score = 92.4 bits (228), Expect = 6e-17 Identities = 45/81 (55%), Positives = 63/81 (77%), Gaps = 1/81 (1%) Frame = -2 Query: 242 SISRVFMVF-FSSETLTSSASGVSLRHRILPAGDPKISVVPVLDQWIEEGRSVQKHELQR 66 SISRVF V +S+ETLTS+A SL+ RI PA D ++S+VP L+QW +EGRS+++ +L R Sbjct: 13 SISRVFRVLPYSTETLTSNAPKESLQSRISPAIDLRVSIVPALEQWRKEGRSIKQQDLHR 72 Query: 65 IVKNLRNYKRFKHALEISEWI 3 +++ LR +KR+ HALEI EWI Sbjct: 73 LIRKLRTFKRYNHALEIYEWI 93 >emb|CAN73453.1| hypothetical protein VITISV_024964 [Vitis vinifera] Length = 499 Score = 92.4 bits (228), Expect = 6e-17 Identities = 45/81 (55%), Positives = 63/81 (77%), Gaps = 1/81 (1%) Frame = -2 Query: 242 SISRVFMVF-FSSETLTSSASGVSLRHRILPAGDPKISVVPVLDQWIEEGRSVQKHELQR 66 SISRVF V +S+ETLTS+A SL+ RI PA D ++S+VP L+QW +EGRS+++ +L R Sbjct: 13 SISRVFRVLPYSTETLTSNAPKESLQSRISPAIDLRVSIVPALEQWRKEGRSIKQQDLHR 72 Query: 65 IVKNLRNYKRFKHALEISEWI 3 +++ LR +KR+ HALEI EWI Sbjct: 73 LIRKLRTFKRYNHALEIYEWI 93 >ref|XP_004168984.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Cucumis sativus] Length = 461 Score = 90.5 bits (223), Expect = 2e-16 Identities = 48/93 (51%), Positives = 61/93 (65%) Frame = -2 Query: 281 MKLLKSSNPWRSISISRVFMVFFSSETLTSSASGVSLRHRILPAGDPKISVVPVLDQWIE 102 MKLL+S P I+ F+ F+S+ + L RI P GDP ISV P+LDQW+ Sbjct: 1 MKLLQSLKPINLIAFRSEFVNFYSTVVKDN------LYRRISPVGDPNISVTPLLDQWVL 54 Query: 101 EGRSVQKHELQRIVKNLRNYKRFKHALEISEWI 3 EGR VQ+ EL+ I+K LR YKRFKHALEIS+W+ Sbjct: 55 EGRLVQQDELRHIIKELRVYKRFKHALEISKWM 87 >ref|XP_004146598.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Cucumis sativus] Length = 227 Score = 90.5 bits (223), Expect = 2e-16 Identities = 48/93 (51%), Positives = 61/93 (65%) Frame = -2 Query: 281 MKLLKSSNPWRSISISRVFMVFFSSETLTSSASGVSLRHRILPAGDPKISVVPVLDQWIE 102 MKLL+S P I+ F+ F+S+ + L RI P GDP ISV P+LDQW+ Sbjct: 1 MKLLQSLKPINLIAFRSEFVNFYSTVVKDN------LYRRISPVGDPNISVTPLLDQWVL 54 Query: 101 EGRSVQKHELQRIVKNLRNYKRFKHALEISEWI 3 EGR VQ+ EL+ I+K LR YKRFKHALEIS+W+ Sbjct: 55 EGRLVQQDELRHIIKELRVYKRFKHALEISKWM 87 >ref|XP_002517926.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223542908|gb|EEF44444.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 504 Score = 89.4 bits (220), Expect = 5e-16 Identities = 46/95 (48%), Positives = 66/95 (69%), Gaps = 1/95 (1%) Frame = -2 Query: 284 LMKLLKSSNPWRS-ISISRVFMVFFSSETLTSSASGVSLRHRILPAGDPKISVVPVLDQW 108 L++L +SN W+S I R + S+ +L+SSA +L RI AG P IS+VP+L++W Sbjct: 3 LLRLGSNSNLWQSGYQILRAQFLSTSTYSLSSSAPIDTLYGRISKAGKPSISIVPILEKW 62 Query: 107 IEEGRSVQKHELQRIVKNLRNYKRFKHALEISEWI 3 +EEG V+K ELQ+ VK LR Y+RF HAL++SEW+ Sbjct: 63 LEEGNDVKKPELQKFVKQLRKYRRFTHALQVSEWM 97 >ref|XP_006376509.1| hypothetical protein POPTR_0013s13650g [Populus trichocarpa] gi|550325785|gb|ERP54306.1| hypothetical protein POPTR_0013s13650g [Populus trichocarpa] Length = 482 Score = 87.8 bits (216), Expect = 1e-15 Identities = 48/101 (47%), Positives = 68/101 (67%), Gaps = 4/101 (3%) Frame = -2 Query: 293 FSLLMKLLKSSNPWRSISISRVFM-VFFSSETLT---SSASGVSLRHRILPAGDPKISVV 126 FS + L N SIS +RV +FFS++T T SS+ +L RI DP++S+V Sbjct: 5 FSRKLFSLLPQNYQFSISSTRVLASLFFSTKTPTKPLSSSHSTTLCRRIEAIRDPRVSIV 64 Query: 125 PVLDQWIEEGRSVQKHELQRIVKNLRNYKRFKHALEISEWI 3 PVLDQW++EG +V KH L +V+ +++YKRFKHALE+SEW+ Sbjct: 65 PVLDQWVKEGNTVDKHHLVSLVRLMKDYKRFKHALEVSEWM 105 >ref|XP_007200782.1| hypothetical protein PRUPE_ppa024012mg [Prunus persica] gi|462396182|gb|EMJ01981.1| hypothetical protein PRUPE_ppa024012mg [Prunus persica] Length = 480 Score = 87.8 bits (216), Expect = 1e-15 Identities = 48/98 (48%), Positives = 68/98 (69%), Gaps = 5/98 (5%) Frame = -2 Query: 281 MKLLKSS-NPWRSISISRVF-MVFFSSETLTSSASGVSLR---HRILPAGDPKISVVPVL 117 MKLL+SS NPWR +ISRVF +F+S+E L SS+S R RI G+P+ S++PVL Sbjct: 1 MKLLRSSSNPWRGYAISRVFGALFYSTEVLPSSSSSPPFRLLHSRIWQIGNPRDSILPVL 60 Query: 116 DQWIEEGRSVQKHELQRIVKNLRNYKRFKHALEISEWI 3 QW EG +++ +LQ ++ LR Y+R+ HAL+ISEW+ Sbjct: 61 HQWRVEGGDMKQPKLQGFIRLLRRYRRYGHALQISEWM 98 >ref|XP_006361033.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Solanum tuberosum] Length = 472 Score = 86.7 bits (213), Expect = 3e-15 Identities = 50/99 (50%), Positives = 67/99 (67%), Gaps = 4/99 (4%) Frame = -2 Query: 287 LLMKLLKSSNPWRSISISR-VFMVFF---SSETLTSSASGVSLRHRILPAGDPKISVVPV 120 LL +L++SN SIS R VF F+ S L +G SL RI P GDP S+VPV Sbjct: 3 LLFSILRNSN---SISNHRNVFNRFYISTPSNHLYRPINGDSLYRRISPLGDPNESIVPV 59 Query: 119 LDQWIEEGRSVQKHELQRIVKNLRNYKRFKHALEISEWI 3 LDQWI+EG+ V K ELQ ++K+L++Y+R+KHALE+S W+ Sbjct: 60 LDQWIKEGKHVVKKELQYMIKSLKDYRRYKHALEVSYWM 98 >gb|EXB79630.1| hypothetical protein L484_011570 [Morus notabilis] Length = 100 Score = 86.3 bits (212), Expect = 4e-15 Identities = 43/83 (51%), Positives = 55/83 (66%) Frame = -2 Query: 263 SNPWRSISISRVFMVFFSSETLTSSASGVSLRHRILPAGDPKISVVPVLDQWIEEGRSVQ 84 +N WR ISRVF F S T + G +L RI GDPKIS++PVL+ W E+GR V Sbjct: 6 ANQWRRFGISRVFSSLFYSTT--RAPKGDTLFQRISRCGDPKISLIPVLNHWAEQGRDVN 63 Query: 83 KHELQRIVKNLRNYKRFKHALEI 15 + ELQRI+K LR Y+RF HAL++ Sbjct: 64 QPELQRIIKQLRKYRRFSHALQL 86 >ref|XP_004168986.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Cucumis sativus] Length = 191 Score = 83.6 bits (205), Expect = 3e-14 Identities = 45/92 (48%), Positives = 58/92 (63%) Frame = -2 Query: 281 MKLLKSSNPWRSISISRVFMVFFSSETLTSSASGVSLRHRILPAGDPKISVVPVLDQWIE 102 MKLL+S P I+ R F+ F+S+ S L RI P GDP ISV P+LDQW+ Sbjct: 1 MKLLQSLKPINLIAFRREFVNFYSTVVKDS------LYRRISPVGDPNISVTPLLDQWVL 54 Query: 101 EGRSVQKHELQRIVKNLRNYKRFKHALEISEW 6 E VQ+ EL+ I+K LR YKRFKHALE+ ++ Sbjct: 55 ESGLVQQDELRHIIKELRVYKRFKHALEVEDY 86 >ref|XP_004146650.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Cucumis sativus] Length = 222 Score = 83.6 bits (205), Expect = 3e-14 Identities = 45/92 (48%), Positives = 58/92 (63%) Frame = -2 Query: 281 MKLLKSSNPWRSISISRVFMVFFSSETLTSSASGVSLRHRILPAGDPKISVVPVLDQWIE 102 MKLL+S P I+ R F+ F+S+ S L RI P GDP ISV P+LDQW+ Sbjct: 1 MKLLQSLKPINLIAFRREFVNFYSTVVKDS------LYRRISPVGDPNISVTPLLDQWVL 54 Query: 101 EGRSVQKHELQRIVKNLRNYKRFKHALEISEW 6 E VQ+ EL+ I+K LR YKRFKHALE+ ++ Sbjct: 55 ESGLVQQDELRHIIKELRVYKRFKHALEVEDY 86 >ref|XP_004155478.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Cucumis sativus] Length = 259 Score = 80.9 bits (198), Expect = 2e-13 Identities = 39/93 (41%), Positives = 61/93 (65%), Gaps = 1/93 (1%) Frame = -2 Query: 281 MKLLKSSNPWRSISISRVFM-VFFSSETLTSSASGVSLRHRILPAGDPKISVVPVLDQWI 105 M L S W S ++ +F+S+++L S ++ +L R+ AGDP+ S+V VLDQW+ Sbjct: 1 MVKLHCSQSWLFCSNFKLLRALFYSTKSLPSPSTEDTLFRRVYRAGDPRTSIVRVLDQWV 60 Query: 104 EEGRSVQKHELQRIVKNLRNYKRFKHALEISEW 6 EEGR V + +LQ+++K LR + RF HAL++ EW Sbjct: 61 EEGRQVNQSDLQKLIKQLRTFGRFNHALQLCEW 93 >ref|XP_004136821.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Cucumis sativus] Length = 486 Score = 80.9 bits (198), Expect = 2e-13 Identities = 39/93 (41%), Positives = 61/93 (65%), Gaps = 1/93 (1%) Frame = -2 Query: 281 MKLLKSSNPWRSISISRVFM-VFFSSETLTSSASGVSLRHRILPAGDPKISVVPVLDQWI 105 M L S W S ++ +F+S+++L S ++ +L R+ AGDP+ S+V VLDQW+ Sbjct: 1 MVKLHCSQSWLFCSNFKLLRALFYSTKSLPSPSTEDTLFRRVYRAGDPRTSIVRVLDQWV 60 Query: 104 EEGRSVQKHELQRIVKNLRNYKRFKHALEISEW 6 EEGR V + +LQ+++K LR + RF HAL++ EW Sbjct: 61 EEGRQVNQSDLQKLIKQLRTFGRFNHALQLCEW 93 >ref|XP_002531596.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223528792|gb|EEF30799.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 300 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/57 (63%), Positives = 44/57 (77%) Frame = -2 Query: 173 LRHRILPAGDPKISVVPVLDQWIEEGRSVQKHELQRIVKNLRNYKRFKHALEISEWI 3 L RI P GDPK+S+VP+LDQWIEEG+SV K +LQ +K LR KR+ HALEIS W+ Sbjct: 51 LYRRISPVGDPKVSIVPILDQWIEEGKSVNKDQLQVFIKELRYCKRYTHALEISMWM 107 >gb|EXC18126.1| hypothetical protein L484_014527 [Morus notabilis] Length = 494 Score = 79.3 bits (194), Expect = 5e-13 Identities = 34/57 (59%), Positives = 46/57 (80%) Frame = -2 Query: 173 LRHRILPAGDPKISVVPVLDQWIEEGRSVQKHELQRIVKNLRNYKRFKHALEISEWI 3 L RI P G+P +SVVP+L+QW++EG+ V + ELQRI+K LR +KRF HALEIS+W+ Sbjct: 59 LYRRISPVGNPNVSVVPILEQWVQEGKPVSQIELQRIIKELRIFKRFHHALEISQWM 115 >ref|XP_002316903.2| hypothetical protein POPTR_0011s12150g [Populus trichocarpa] gi|550328208|gb|EEE97515.2| hypothetical protein POPTR_0011s12150g [Populus trichocarpa] Length = 500 Score = 79.0 bits (193), Expect = 7e-13 Identities = 35/58 (60%), Positives = 46/58 (79%) Frame = -2 Query: 176 SLRHRILPAGDPKISVVPVLDQWIEEGRSVQKHELQRIVKNLRNYKRFKHALEISEWI 3 +L RI P GDP+IS+ PVLDQW+EEG+ V+ +EL+ IVK LR KRFK ALE+S+W+ Sbjct: 35 NLYSRISPLGDPRISLAPVLDQWVEEGKKVKDYELRTIVKGLRERKRFKQALEVSQWM 92 >ref|XP_006347050.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Solanum tuberosum] Length = 478 Score = 78.6 bits (192), Expect = 9e-13 Identities = 33/54 (61%), Positives = 44/54 (81%) Frame = -2 Query: 164 RILPAGDPKISVVPVLDQWIEEGRSVQKHELQRIVKNLRNYKRFKHALEISEWI 3 RI P G P +S+VPVL+QW+EEG++V K ELQ I+K L +YKR+KHALE+S W+ Sbjct: 45 RIAPLGSPDVSMVPVLEQWVEEGKTVVKSELQWIIKRLNSYKRYKHALEVSHWM 98 >ref|XP_007211848.1| hypothetical protein PRUPE_ppa004720mg [Prunus persica] gi|462407713|gb|EMJ13047.1| hypothetical protein PRUPE_ppa004720mg [Prunus persica] Length = 494 Score = 78.6 bits (192), Expect = 9e-13 Identities = 36/63 (57%), Positives = 49/63 (77%) Frame = -2 Query: 191 SASGVSLRHRILPAGDPKISVVPVLDQWIEEGRSVQKHELQRIVKNLRNYKRFKHALEIS 12 +A+ +L RI P GDP +SVVPVLDQW++EG V ELQRIV++LR KR++HAL++S Sbjct: 31 TANTRNLFSRISPLGDPSLSVVPVLDQWVQEGGKVNYFELQRIVRDLRARKRYRHALDVS 90 Query: 11 EWI 3 EW+ Sbjct: 91 EWM 93