BLASTX nr result
ID: Paeonia23_contig00044387
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00044387 (222 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007018466.1| Endoplasmic reticulum-type calcium-transport... 62 8e-08 ref|XP_007018465.1| Endoplasmic reticulum-type calcium-transport... 62 8e-08 ref|XP_006857120.1| hypothetical protein AMTR_s00065p00134450 [A... 61 1e-07 ref|XP_006347866.1| PREDICTED: calcium-transporting ATPase 3, en... 61 2e-07 ref|XP_006347865.1| PREDICTED: calcium-transporting ATPase 3, en... 61 2e-07 ref|XP_004242949.1| PREDICTED: calcium-transporting ATPase 3, en... 61 2e-07 ref|XP_002285405.1| PREDICTED: calcium-transporting ATPase 3, en... 59 5e-07 emb|CBI19381.3| unnamed protein product [Vitis vinifera] 59 5e-07 ref|XP_007227661.1| hypothetical protein PRUPE_ppa000801mg [Prun... 59 7e-07 ref|XP_006472319.1| PREDICTED: calcium-transporting ATPase 3, en... 57 3e-06 ref|XP_006472318.1| PREDICTED: calcium-transporting ATPase 3, en... 57 3e-06 ref|XP_006433652.1| hypothetical protein CICLE_v10000142mg [Citr... 57 3e-06 ref|XP_006433651.1| hypothetical protein CICLE_v10000142mg [Citr... 57 3e-06 gb|EPS69623.1| hypothetical protein M569_05142, partial [Genlise... 57 4e-06 gb|AAD29961.1|AF117296_1 putative endoplasmic reticulum-type cal... 56 5e-06 ref|NP_563860.1| calcium-transporting ATPase 3, ER-type [Arabido... 56 5e-06 ref|XP_002889791.1| Ca2+-ATPase [Arabidopsis lyrata subsp. lyrat... 56 5e-06 gb|AAT68271.1| ECA3 [Arabidopsis thaliana] 56 5e-06 emb|CAA10660.1| Ca2+-ATPase [Arabidopsis thaliana] 56 5e-06 ref|XP_006417494.1| hypothetical protein EUTSA_v10006682mg [Eutr... 56 6e-06 >ref|XP_007018466.1| Endoplasmic reticulum-type calcium-transporting ATPase 3 isoform 2 [Theobroma cacao] gi|508723794|gb|EOY15691.1| Endoplasmic reticulum-type calcium-transporting ATPase 3 isoform 2 [Theobroma cacao] Length = 734 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = +1 Query: 112 MEDAYARSVTEVLEFFRVDSTKGLTDLQVTENGRIYG 222 MEDAYARSV+EVL+FF VDSTKGLTD QV+++ R+YG Sbjct: 1 MEDAYARSVSEVLDFFEVDSTKGLTDTQVSQHARLYG 37 >ref|XP_007018465.1| Endoplasmic reticulum-type calcium-transporting ATPase 3 isoform 1 [Theobroma cacao] gi|508723793|gb|EOY15690.1| Endoplasmic reticulum-type calcium-transporting ATPase 3 isoform 1 [Theobroma cacao] Length = 1001 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = +1 Query: 112 MEDAYARSVTEVLEFFRVDSTKGLTDLQVTENGRIYG 222 MEDAYARSV+EVL+FF VDSTKGLTD QV+++ R+YG Sbjct: 1 MEDAYARSVSEVLDFFEVDSTKGLTDTQVSQHARLYG 37 >ref|XP_006857120.1| hypothetical protein AMTR_s00065p00134450 [Amborella trichopoda] gi|548861203|gb|ERN18587.1| hypothetical protein AMTR_s00065p00134450 [Amborella trichopoda] Length = 1001 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +1 Query: 112 MEDAYARSVTEVLEFFRVDSTKGLTDLQVTENGRIYG 222 MEDAYARS++EVLE FRVD TKGL DLQV EN R YG Sbjct: 1 MEDAYARSISEVLEAFRVDPTKGLADLQVAENARTYG 37 >ref|XP_006347866.1| PREDICTED: calcium-transporting ATPase 3, endoplasmic reticulum-type-like isoform X2 [Solanum tuberosum] Length = 920 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +1 Query: 112 MEDAYARSVTEVLEFFRVDSTKGLTDLQVTENGRIYG 222 MEDAYARSV+EVLEFF VD TKGLTDLQVT++ YG Sbjct: 1 MEDAYARSVSEVLEFFAVDPTKGLTDLQVTQHAHSYG 37 >ref|XP_006347865.1| PREDICTED: calcium-transporting ATPase 3, endoplasmic reticulum-type-like isoform X1 [Solanum tuberosum] Length = 1000 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +1 Query: 112 MEDAYARSVTEVLEFFRVDSTKGLTDLQVTENGRIYG 222 MEDAYARSV+EVLEFF VD TKGLTDLQVT++ YG Sbjct: 1 MEDAYARSVSEVLEFFAVDPTKGLTDLQVTQHAHSYG 37 >ref|XP_004242949.1| PREDICTED: calcium-transporting ATPase 3, endoplasmic reticulum-type-like [Solanum lycopersicum] Length = 1000 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +1 Query: 112 MEDAYARSVTEVLEFFRVDSTKGLTDLQVTENGRIYG 222 MEDAYARSV+EVLEFF VD TKGLTDLQVT++ YG Sbjct: 1 MEDAYARSVSEVLEFFAVDPTKGLTDLQVTQHAHSYG 37 >ref|XP_002285405.1| PREDICTED: calcium-transporting ATPase 3, endoplasmic reticulum-type-like [Vitis vinifera] Length = 999 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +1 Query: 112 MEDAYARSVTEVLEFFRVDSTKGLTDLQVTENGRIYG 222 MEDAYARSV EVLEFF VD TKGLTD Q+++ RIYG Sbjct: 1 MEDAYARSVAEVLEFFEVDPTKGLTDSQISKYARIYG 37 >emb|CBI19381.3| unnamed protein product [Vitis vinifera] Length = 1000 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +1 Query: 112 MEDAYARSVTEVLEFFRVDSTKGLTDLQVTENGRIYG 222 MEDAYARSV EVLEFF VD TKGLTD Q+++ RIYG Sbjct: 1 MEDAYARSVAEVLEFFEVDPTKGLTDSQISKYARIYG 37 >ref|XP_007227661.1| hypothetical protein PRUPE_ppa000801mg [Prunus persica] gi|462424597|gb|EMJ28860.1| hypothetical protein PRUPE_ppa000801mg [Prunus persica] Length = 999 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +1 Query: 112 MEDAYARSVTEVLEFFRVDSTKGLTDLQVTENGRIYG 222 MEDAYARSVTEVL+FF VD +GLTD QVT++ R+YG Sbjct: 1 MEDAYARSVTEVLDFFGVDPKRGLTDAQVTQHARLYG 37 >ref|XP_006472319.1| PREDICTED: calcium-transporting ATPase 3, endoplasmic reticulum-type-like isoform X2 [Citrus sinensis] Length = 992 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = +1 Query: 112 MEDAYARSVTEVLEFFRVDSTKGLTDLQVTENGRIYG 222 MEDAYARSV EVL+FF VD TKGLTD QV + RIYG Sbjct: 1 MEDAYARSVVEVLDFFGVDPTKGLTDSQVARHVRIYG 37 >ref|XP_006472318.1| PREDICTED: calcium-transporting ATPase 3, endoplasmic reticulum-type-like isoform X1 [Citrus sinensis] Length = 1001 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = +1 Query: 112 MEDAYARSVTEVLEFFRVDSTKGLTDLQVTENGRIYG 222 MEDAYARSV EVL+FF VD TKGLTD QV + RIYG Sbjct: 1 MEDAYARSVVEVLDFFGVDPTKGLTDSQVARHVRIYG 37 >ref|XP_006433652.1| hypothetical protein CICLE_v10000142mg [Citrus clementina] gi|557535774|gb|ESR46892.1| hypothetical protein CICLE_v10000142mg [Citrus clementina] Length = 1001 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = +1 Query: 112 MEDAYARSVTEVLEFFRVDSTKGLTDLQVTENGRIYG 222 MEDAYARSV EVL+FF VD TKGLTD QV + RIYG Sbjct: 1 MEDAYARSVVEVLDFFGVDPTKGLTDSQVARHVRIYG 37 >ref|XP_006433651.1| hypothetical protein CICLE_v10000142mg [Citrus clementina] gi|557535773|gb|ESR46891.1| hypothetical protein CICLE_v10000142mg [Citrus clementina] Length = 787 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = +1 Query: 112 MEDAYARSVTEVLEFFRVDSTKGLTDLQVTENGRIYG 222 MEDAYARSV EVL+FF VD TKGLTD QV + RIYG Sbjct: 1 MEDAYARSVVEVLDFFGVDPTKGLTDSQVARHVRIYG 37 >gb|EPS69623.1| hypothetical protein M569_05142, partial [Genlisea aurea] Length = 861 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = +1 Query: 112 MEDAYARSVTEVLEFFRVDSTKGLTDLQVTENGRIYG 222 MEDA+ARSV EVLEFF VD +GL D QV E GR+YG Sbjct: 1 MEDAFARSVNEVLEFFNVDPARGLADFQVAEYGRLYG 37 >gb|AAD29961.1|AF117296_1 putative endoplasmic reticulum-type calcium-transporting ATPase 3 [Arabidopsis thaliana] Length = 998 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +1 Query: 112 MEDAYARSVTEVLEFFRVDSTKGLTDLQVTENGRIYG 222 MEDAYARSV+EVL+FF VD TKGL+D QV + R+YG Sbjct: 1 MEDAYARSVSEVLDFFGVDPTKGLSDSQVVHHSRLYG 37 >ref|NP_563860.1| calcium-transporting ATPase 3, ER-type [Arabidopsis thaliana] gi|19865112|sp|Q9SY55.3|ECA3_ARATH RecName: Full=Calcium-transporting ATPase 3, endoplasmic reticulum-type; Short=AtECA3 gi|13162529|gb|AAC34328.2| calcium-transporting ATPase, ECA3 [Arabidopsis thaliana] gi|110738280|dbj|BAF01069.1| putative calcium ATPase [Arabidopsis thaliana] gi|156145808|gb|ABU53680.1| endomembrane calcium ATPase 3 [Arabidopsis thaliana] gi|332190424|gb|AEE28545.1| calcium-transporting ATPase 3 [Arabidopsis thaliana] Length = 998 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +1 Query: 112 MEDAYARSVTEVLEFFRVDSTKGLTDLQVTENGRIYG 222 MEDAYARSV+EVL+FF VD TKGL+D QV + R+YG Sbjct: 1 MEDAYARSVSEVLDFFGVDPTKGLSDSQVVHHSRLYG 37 >ref|XP_002889791.1| Ca2+-ATPase [Arabidopsis lyrata subsp. lyrata] gi|297335633|gb|EFH66050.1| Ca2+-ATPase [Arabidopsis lyrata subsp. lyrata] Length = 992 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +1 Query: 112 MEDAYARSVTEVLEFFRVDSTKGLTDLQVTENGRIYG 222 MEDAYARSV+EVL+FF VD TKGL+D QV + R+YG Sbjct: 1 MEDAYARSVSEVLDFFGVDPTKGLSDSQVVHHSRLYG 37 >gb|AAT68271.1| ECA3 [Arabidopsis thaliana] Length = 997 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +1 Query: 112 MEDAYARSVTEVLEFFRVDSTKGLTDLQVTENGRIYG 222 MEDAYARSV+EVL+FF VD TKGL+D QV + R+YG Sbjct: 1 MEDAYARSVSEVLDFFGVDPTKGLSDSQVVHHSRLYG 37 >emb|CAA10660.1| Ca2+-ATPase [Arabidopsis thaliana] Length = 998 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +1 Query: 112 MEDAYARSVTEVLEFFRVDSTKGLTDLQVTENGRIYG 222 MEDAYARSV+EVL+FF VD TKGL+D QV + R+YG Sbjct: 1 MEDAYARSVSEVLDFFGVDPTKGLSDSQVVHHSRLYG 37 >ref|XP_006417494.1| hypothetical protein EUTSA_v10006682mg [Eutrema salsugineum] gi|557095265|gb|ESQ35847.1| hypothetical protein EUTSA_v10006682mg [Eutrema salsugineum] Length = 722 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +1 Query: 112 MEDAYARSVTEVLEFFRVDSTKGLTDLQVTENGRIYG 222 MEDAYARSVTEVL+FF VD TKGL+D QV + R++G Sbjct: 1 MEDAYARSVTEVLDFFGVDPTKGLSDSQVDHHSRLFG 37