BLASTX nr result
ID: Paeonia23_contig00044215
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00044215 (285 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004292553.1| PREDICTED: pentatricopeptide repeat-containi... 165 7e-39 ref|XP_007043745.1| Tetratricopeptide repeat-like superfamily pr... 164 2e-38 ref|XP_002271484.1| PREDICTED: pentatricopeptide repeat-containi... 162 3e-38 emb|CAN72195.1| hypothetical protein VITISV_014979 [Vitis vinifera] 162 3e-38 ref|XP_007212561.1| hypothetical protein PRUPE_ppa015401mg [Prun... 162 6e-38 ref|XP_004164277.1| PREDICTED: pentatricopeptide repeat-containi... 159 3e-37 ref|XP_004152003.1| PREDICTED: pentatricopeptide repeat-containi... 156 2e-36 ref|XP_004503027.1| PREDICTED: pentatricopeptide repeat-containi... 152 5e-35 ref|XP_003602717.1| Pentatricopeptide repeat-containing protein ... 151 8e-35 ref|XP_003528083.1| PREDICTED: pentatricopeptide repeat-containi... 144 1e-32 ref|XP_007137833.1| hypothetical protein PHAVU_009G159500g [Phas... 142 6e-32 ref|XP_007211285.1| hypothetical protein PRUPE_ppa002699mg [Prun... 129 5e-28 ref|XP_004303287.1| PREDICTED: putative pentatricopeptide repeat... 128 7e-28 gb|EXB93905.1| hypothetical protein L484_002061 [Morus notabilis] 128 9e-28 ref|XP_007212650.1| hypothetical protein PRUPE_ppa018206mg, part... 126 3e-27 ref|XP_007155315.1| hypothetical protein PHAVU_003G190600g [Phas... 126 4e-27 ref|XP_003609069.1| Pentatricopeptide repeat protein [Medicago t... 126 4e-27 ref|XP_007046082.1| Pentatricopeptide repeat (PPR) superfamily p... 125 5e-27 ref|XP_003558728.1| PREDICTED: pentatricopeptide repeat-containi... 125 5e-27 ref|XP_003613787.1| Pentatricopeptide repeat-containing protein ... 125 5e-27 >ref|XP_004292553.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Fragaria vesca subsp. vesca] Length = 563 Score = 165 bits (417), Expect = 7e-39 Identities = 71/94 (75%), Positives = 86/94 (91%) Frame = -3 Query: 283 PDHITFNGVLVACSHGGLLDDGWQVFNSIRNEHGIEPTLEHYGCMVDLLGREGLLCEAYE 104 PDH++ G+LVACSHGGL+ DGW+VF S+++E+G+EP L+HYGCMVDLLGR GLLCEAYE Sbjct: 290 PDHMSITGILVACSHGGLVQDGWRVFKSMKDEYGLEPMLKHYGCMVDLLGRAGLLCEAYE 349 Query: 103 FVNRMPIRPNSIIWRTLLGACVNHNNLELAEKVK 2 FV +MPIRPNS+IWRTLLGACVNHN+L LA+KVK Sbjct: 350 FVEKMPIRPNSVIWRTLLGACVNHNHLVLAKKVK 383 >ref|XP_007043745.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] gi|508707680|gb|EOX99576.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] Length = 558 Score = 164 bits (414), Expect = 2e-38 Identities = 71/94 (75%), Positives = 85/94 (90%) Frame = -3 Query: 283 PDHITFNGVLVACSHGGLLDDGWQVFNSIRNEHGIEPTLEHYGCMVDLLGREGLLCEAYE 104 PDH+TFNGVLVAC+HGGL+DDGW+VFNSI +G+EPT++HYGCMVDLLGR G L EA+E Sbjct: 285 PDHVTFNGVLVACTHGGLVDDGWRVFNSIEKVYGMEPTVQHYGCMVDLLGRAGFLHEAFE 344 Query: 103 FVNRMPIRPNSIIWRTLLGACVNHNNLELAEKVK 2 FV+RMP RPN++IWRTLLGACV HN+L+LAEK K Sbjct: 345 FVDRMPARPNAVIWRTLLGACVKHNDLKLAEKAK 378 >ref|XP_002271484.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Vitis vinifera] Length = 558 Score = 162 bits (411), Expect = 3e-38 Identities = 75/94 (79%), Positives = 83/94 (88%) Frame = -3 Query: 283 PDHITFNGVLVACSHGGLLDDGWQVFNSIRNEHGIEPTLEHYGCMVDLLGREGLLCEAYE 104 PDH+TF GVLVACSHGGL+ +GW VF SIRNE+G+EP EHYGCMVDLLGR GLL EA + Sbjct: 285 PDHVTFTGVLVACSHGGLVSEGWHVFESIRNEYGMEPLPEHYGCMVDLLGRAGLLNEACK 344 Query: 103 FVNRMPIRPNSIIWRTLLGACVNHNNLELAEKVK 2 FV+ MPIRPNSIIWRTLLGACVNHN +ELAEKVK Sbjct: 345 FVDGMPIRPNSIIWRTLLGACVNHNYIELAEKVK 378 >emb|CAN72195.1| hypothetical protein VITISV_014979 [Vitis vinifera] Length = 558 Score = 162 bits (411), Expect = 3e-38 Identities = 75/94 (79%), Positives = 83/94 (88%) Frame = -3 Query: 283 PDHITFNGVLVACSHGGLLDDGWQVFNSIRNEHGIEPTLEHYGCMVDLLGREGLLCEAYE 104 PDH+TF GVLVACSHGGL+ +GW VF SIRNE+G+EP EHYGCMVDLLGR GLL EA + Sbjct: 285 PDHVTFTGVLVACSHGGLVSEGWHVFESIRNEYGMEPLPEHYGCMVDLLGRAGLLNEACK 344 Query: 103 FVNRMPIRPNSIIWRTLLGACVNHNNLELAEKVK 2 FV+ MPIRPNSIIWRTLLGACVNHN +ELAEKVK Sbjct: 345 FVDGMPIRPNSIIWRTLLGACVNHNYIELAEKVK 378 >ref|XP_007212561.1| hypothetical protein PRUPE_ppa015401mg [Prunus persica] gi|462408426|gb|EMJ13760.1| hypothetical protein PRUPE_ppa015401mg [Prunus persica] Length = 484 Score = 162 bits (409), Expect = 6e-38 Identities = 72/94 (76%), Positives = 83/94 (88%) Frame = -3 Query: 283 PDHITFNGVLVACSHGGLLDDGWQVFNSIRNEHGIEPTLEHYGCMVDLLGREGLLCEAYE 104 PDHI GVLVACSHGGL+DDGW+VF SI +E+G++PTLEHYGCMVDLLGR GLL EAYE Sbjct: 211 PDHIAITGVLVACSHGGLVDDGWRVFKSIEDEYGLKPTLEHYGCMVDLLGRAGLLHEAYE 270 Query: 103 FVNRMPIRPNSIIWRTLLGACVNHNNLELAEKVK 2 FV +M +RPN ++WRTLLGACVNHN+L LAEKVK Sbjct: 271 FVEKMLVRPNPVVWRTLLGACVNHNHLALAEKVK 304 >ref|XP_004164277.1| PREDICTED: pentatricopeptide repeat-containing protein At5g48910-like [Cucumis sativus] Length = 558 Score = 159 bits (403), Expect = 3e-37 Identities = 70/94 (74%), Positives = 84/94 (89%) Frame = -3 Query: 283 PDHITFNGVLVACSHGGLLDDGWQVFNSIRNEHGIEPTLEHYGCMVDLLGREGLLCEAYE 104 PD++TF+GVLVACSHGGL+ +GW +F SIR +G++P L+HYGCMVD+LGR GLL EAY+ Sbjct: 285 PDYVTFSGVLVACSHGGLVKEGWDIFESIRKVYGMDPLLDHYGCMVDILGRAGLLNEAYD 344 Query: 103 FVNRMPIRPNSIIWRTLLGACVNHNNLELAEKVK 2 FV RMP++PNSIIWRTLLGACVNHNNL LAEKVK Sbjct: 345 FVERMPMKPNSIIWRTLLGACVNHNNLGLAEKVK 378 >ref|XP_004152003.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Cucumis sativus] Length = 558 Score = 156 bits (395), Expect = 2e-36 Identities = 69/94 (73%), Positives = 83/94 (88%) Frame = -3 Query: 283 PDHITFNGVLVACSHGGLLDDGWQVFNSIRNEHGIEPTLEHYGCMVDLLGREGLLCEAYE 104 PD++TF+GVLVACSHGGL+ +GW +F SIR + ++P L+HYGCMVD+LGR GLL EAY+ Sbjct: 285 PDYVTFSGVLVACSHGGLVKEGWDIFESIRKVYRMDPLLDHYGCMVDILGRAGLLNEAYD 344 Query: 103 FVNRMPIRPNSIIWRTLLGACVNHNNLELAEKVK 2 FV RMP++PNSIIWRTLLGACVNHNNL LAEKVK Sbjct: 345 FVERMPMKPNSIIWRTLLGACVNHNNLGLAEKVK 378 >ref|XP_004503027.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Cicer arietinum] Length = 561 Score = 152 bits (384), Expect = 5e-35 Identities = 68/94 (72%), Positives = 79/94 (84%) Frame = -3 Query: 283 PDHITFNGVLVACSHGGLLDDGWQVFNSIRNEHGIEPTLEHYGCMVDLLGREGLLCEAYE 104 PD F LVACSHGGL++DGW+VF S+R+E GIEP LEHYGCMVDLLGR GLL EA+E Sbjct: 288 PDRAAFIAALVACSHGGLVEDGWRVFRSMRDEFGIEPMLEHYGCMVDLLGRAGLLVEAFE 347 Query: 103 FVNRMPIRPNSIIWRTLLGACVNHNNLELAEKVK 2 FV MP++PNS+IWRTLLGACVNHN+L LAEK + Sbjct: 348 FVEEMPLKPNSVIWRTLLGACVNHNHLVLAEKAR 381 >ref|XP_003602717.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355491765|gb|AES72968.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 554 Score = 151 bits (382), Expect = 8e-35 Identities = 67/94 (71%), Positives = 81/94 (86%) Frame = -3 Query: 283 PDHITFNGVLVACSHGGLLDDGWQVFNSIRNEHGIEPTLEHYGCMVDLLGREGLLCEAYE 104 PD F GVLVACSHGGL++DGW+VF S+R+E GI+P LEHYGCMVDLLGR GL+ EA++ Sbjct: 281 PDGALFIGVLVACSHGGLVEDGWRVFESMRDEFGIKPMLEHYGCMVDLLGRAGLILEAFD 340 Query: 103 FVNRMPIRPNSIIWRTLLGACVNHNNLELAEKVK 2 FV MP++PNS+IWRTLLGACVNHN+L LAEK + Sbjct: 341 FVEEMPLKPNSVIWRTLLGACVNHNHLGLAEKAR 374 >ref|XP_003528083.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Glycine max] Length = 568 Score = 144 bits (363), Expect = 1e-32 Identities = 66/94 (70%), Positives = 80/94 (85%) Frame = -3 Query: 283 PDHITFNGVLVACSHGGLLDDGWQVFNSIRNEHGIEPTLEHYGCMVDLLGREGLLCEAYE 104 PD I F GVLVACSHGGL+++G +VF+S+ +E+GIEP LEHYGCMVDLLGR G++ EA++ Sbjct: 295 PDRIAFMGVLVACSHGGLVEEGRRVFSSMWSEYGIEPALEHYGCMVDLLGRAGMVLEAFD 354 Query: 103 FVNRMPIRPNSIIWRTLLGACVNHNNLELAEKVK 2 FV M +RPNS+IWRTLLGACVNHN L LAEK K Sbjct: 355 FVEGMRVRPNSVIWRTLLGACVNHNLLVLAEKAK 388 >ref|XP_007137833.1| hypothetical protein PHAVU_009G159500g [Phaseolus vulgaris] gi|561010920|gb|ESW09827.1| hypothetical protein PHAVU_009G159500g [Phaseolus vulgaris] Length = 567 Score = 142 bits (357), Expect = 6e-32 Identities = 64/94 (68%), Positives = 77/94 (81%) Frame = -3 Query: 283 PDHITFNGVLVACSHGGLLDDGWQVFNSIRNEHGIEPTLEHYGCMVDLLGREGLLCEAYE 104 PD + F G LVACSHGG +++G QVF + +++G+EP LEHYGCMVDLLGR G L EA+E Sbjct: 294 PDCVAFMGALVACSHGGFVEEGQQVFQGMWSKYGVEPALEHYGCMVDLLGRAGKLLEAFE 353 Query: 103 FVNRMPIRPNSIIWRTLLGACVNHNNLELAEKVK 2 FV RM ++PNSIIWRTLLGACVNHN+L LAEK K Sbjct: 354 FVERMRVKPNSIIWRTLLGACVNHNHLGLAEKAK 387 >ref|XP_007211285.1| hypothetical protein PRUPE_ppa002699mg [Prunus persica] gi|462407020|gb|EMJ12484.1| hypothetical protein PRUPE_ppa002699mg [Prunus persica] Length = 643 Score = 129 bits (323), Expect = 5e-28 Identities = 57/94 (60%), Positives = 75/94 (79%) Frame = -3 Query: 283 PDHITFNGVLVACSHGGLLDDGWQVFNSIRNEHGIEPTLEHYGCMVDLLGREGLLCEAYE 104 PD ITF VL ACSH GL+D+G + F+ +R +GIEP +EHYGCMVDL GR G L +AY+ Sbjct: 369 PDGITFISVLYACSHAGLIDEGCEYFSKMRYLYGIEPAIEHYGCMVDLYGRAGKLQKAYD 428 Query: 103 FVNRMPIRPNSIIWRTLLGACVNHNNLELAEKVK 2 FV+++P+ PN+++WRTLLGAC H N+ELAE+VK Sbjct: 429 FVSQLPMSPNAVVWRTLLGACSIHGNVELAEQVK 462 >ref|XP_004303287.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15930-like [Fragaria vesca subsp. vesca] Length = 693 Score = 128 bits (322), Expect = 7e-28 Identities = 57/93 (61%), Positives = 71/93 (76%) Frame = -3 Query: 283 PDHITFNGVLVACSHGGLLDDGWQVFNSIRNEHGIEPTLEHYGCMVDLLGREGLLCEAYE 104 PD IT+ GVL AC+H G++D+G +F+S+ +HGIEPT+ HYGCMVDLLGR G L EAYE Sbjct: 420 PDKITYLGVLCACTHSGMVDEGTNIFSSMSTQHGIEPTVTHYGCMVDLLGRAGRLKEAYE 479 Query: 103 FVNRMPIRPNSIIWRTLLGACVNHNNLELAEKV 5 + MPI PNS++W TLLGAC H + ELAE V Sbjct: 480 VIQNMPIEPNSVVWGTLLGACRMHKDAELAEVV 512 >gb|EXB93905.1| hypothetical protein L484_002061 [Morus notabilis] Length = 705 Score = 128 bits (321), Expect = 9e-28 Identities = 53/92 (57%), Positives = 75/92 (81%) Frame = -3 Query: 283 PDHITFNGVLVACSHGGLLDDGWQVFNSIRNEHGIEPTLEHYGCMVDLLGREGLLCEAYE 104 P+ +TF GVL ACSH GL+++G ++F S+ N++GIEP +EHYGCMVD+LGR GL+ EAYE Sbjct: 430 PNDVTFIGVLSACSHAGLVEEGRKLFISMSNDYGIEPRIEHYGCMVDILGRSGLIQEAYE 489 Query: 103 FVNRMPIRPNSIIWRTLLGACVNHNNLELAEK 8 F+ MPIRPN+++WRTLL +C H N+++ E+ Sbjct: 490 FIKNMPIRPNAVVWRTLLASCKAHKNVKIGEE 521 >ref|XP_007212650.1| hypothetical protein PRUPE_ppa018206mg, partial [Prunus persica] gi|462408515|gb|EMJ13849.1| hypothetical protein PRUPE_ppa018206mg, partial [Prunus persica] Length = 604 Score = 126 bits (317), Expect = 3e-27 Identities = 54/94 (57%), Positives = 72/94 (76%) Frame = -3 Query: 283 PDHITFNGVLVACSHGGLLDDGWQVFNSIRNEHGIEPTLEHYGCMVDLLGREGLLCEAYE 104 P ITF GVL ACSH G++D+G+ F ++ E+GI P +EHYGCM+DLLGR GL+ EAYE Sbjct: 331 PTEITFVGVLYACSHCGMVDEGFNYFRMMKEEYGIVPRIEHYGCMIDLLGRAGLVKEAYE 390 Query: 103 FVNRMPIRPNSIIWRTLLGACVNHNNLELAEKVK 2 ++N MP++PN++IWRTLLGAC H +L L E + Sbjct: 391 YINNMPMQPNAVIWRTLLGACTIHGHLALGETAR 424 >ref|XP_007155315.1| hypothetical protein PHAVU_003G190600g [Phaseolus vulgaris] gi|561028669|gb|ESW27309.1| hypothetical protein PHAVU_003G190600g [Phaseolus vulgaris] Length = 626 Score = 126 bits (316), Expect = 4e-27 Identities = 57/94 (60%), Positives = 72/94 (76%) Frame = -3 Query: 283 PDHITFNGVLVACSHGGLLDDGWQVFNSIRNEHGIEPTLEHYGCMVDLLGREGLLCEAYE 104 PD ITF +L ACSH GL+++G+ F+ ++N +GIEP +EHYGCMVDL GR L +AYE Sbjct: 352 PDGITFISLLYACSHSGLVEEGYVFFSKMKNLYGIEPAIEHYGCMVDLYGRAARLQKAYE 411 Query: 103 FVNRMPIRPNSIIWRTLLGACVNHNNLELAEKVK 2 F+ MP+ PN+IIWRTLLGAC H N+ELAE VK Sbjct: 412 FICEMPVSPNAIIWRTLLGACSIHGNIELAELVK 445 >ref|XP_003609069.1| Pentatricopeptide repeat protein [Medicago truncatula] gi|355510124|gb|AES91266.1| Pentatricopeptide repeat protein [Medicago truncatula] Length = 611 Score = 126 bits (316), Expect = 4e-27 Identities = 58/94 (61%), Positives = 71/94 (75%) Frame = -3 Query: 283 PDHITFNGVLVACSHGGLLDDGWQVFNSIRNEHGIEPTLEHYGCMVDLLGREGLLCEAYE 104 PD +TF +L ACSH GL++ G +F+ +RN +GIEP +EHYGCMVDL GR L +AYE Sbjct: 337 PDGVTFISLLYACSHSGLVEQGCALFSKMRNFYGIEPAIEHYGCMVDLYGRAARLQKAYE 396 Query: 103 FVNRMPIRPNSIIWRTLLGACVNHNNLELAEKVK 2 F+ +MPI PN IIWRTLLGAC H N+ELAE VK Sbjct: 397 FIRQMPILPNVIIWRTLLGACSIHGNIELAELVK 430 >ref|XP_007046082.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] gi|508710017|gb|EOY01914.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 604 Score = 125 bits (315), Expect = 5e-27 Identities = 53/93 (56%), Positives = 74/93 (79%) Frame = -3 Query: 283 PDHITFNGVLVACSHGGLLDDGWQVFNSIRNEHGIEPTLEHYGCMVDLLGREGLLCEAYE 104 PD ITF G+L ACSH GL+++GW F+SI N++GI P ++HYGCMVDLLGR G + EAY+ Sbjct: 330 PDEITFLGLLYACSHNGLVEEGWWYFSSITNKYGIVPGIKHYGCMVDLLGRTGRIDEAYK 389 Query: 103 FVNRMPIRPNSIIWRTLLGACVNHNNLELAEKV 5 F++ +PI+P I+WRTLL AC +H ++EL ++V Sbjct: 390 FIDELPIKPTPILWRTLLAACSSHGDVELGKRV 422 >ref|XP_003558728.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like [Brachypodium distachyon] Length = 532 Score = 125 bits (315), Expect = 5e-27 Identities = 55/91 (60%), Positives = 72/91 (79%) Frame = -3 Query: 283 PDHITFNGVLVACSHGGLLDDGWQVFNSIRNEHGIEPTLEHYGCMVDLLGREGLLCEAYE 104 PD ITF VL+ACSHGG++D G + FN +++ + IEP ++HYGCMVD+LGR GLL EA+E Sbjct: 376 PDEITFVAVLIACSHGGMVDKGREYFNLMQHHYRIEPNVKHYGCMVDMLGRAGLLKEAFE 435 Query: 103 FVNRMPIRPNSIIWRTLLGACVNHNNLELAE 11 F++ M + PNS+IWRTLLGAC H +ELAE Sbjct: 436 FIDTMKVEPNSVIWRTLLGACRVHGEIELAE 466 >ref|XP_003613787.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355515122|gb|AES96745.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 586 Score = 125 bits (315), Expect = 5e-27 Identities = 52/93 (55%), Positives = 74/93 (79%) Frame = -3 Query: 283 PDHITFNGVLVACSHGGLLDDGWQVFNSIRNEHGIEPTLEHYGCMVDLLGREGLLCEAYE 104 PD ITF G+L ACSH GL+++G++ F+ + NE+GI P+++HYGCMVDLLGR G L EAY+ Sbjct: 312 PDEITFLGILYACSHNGLVEEGFEYFHGMTNEYGIVPSIKHYGCMVDLLGRAGRLDEAYK 371 Query: 103 FVNRMPIRPNSIIWRTLLGACVNHNNLELAEKV 5 F++ +PI+P I+WRTLL AC H N+E+ ++V Sbjct: 372 FIDELPIKPTPILWRTLLSACSTHGNVEMGKRV 404