BLASTX nr result
ID: Paeonia23_contig00044057
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00044057 (366 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN68803.1| hypothetical protein VITISV_008948 [Vitis vinifera] 62 6e-08 >emb|CAN68803.1| hypothetical protein VITISV_008948 [Vitis vinifera] Length = 333 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/64 (45%), Positives = 41/64 (64%) Frame = -2 Query: 194 KVENTEDLTINCDSLFDRTQQNLKFWCKMCKVGTNNEKSMEAHRSGEIHRNLLKKNGGGL 15 ++E ED+ + L + Q NLKFWC+ CK+GT +E M+ H++G+ H LKKN G L Sbjct: 163 EMEAQEDMCKGDEFLLNIRQTNLKFWCQTCKIGTTSEDLMKKHQNGKKHMAKLKKNSGTL 222 Query: 14 MVIS 3 M IS Sbjct: 223 MAIS 226