BLASTX nr result
ID: Paeonia23_contig00043854
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00043854 (262 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007203318.1| hypothetical protein PRUPE_ppa019964mg, part... 63 9e-11 ref|XP_007219137.1| hypothetical protein PRUPE_ppa015965mg [Prun... 63 9e-11 ref|XP_007224256.1| hypothetical protein PRUPE_ppa018408mg, part... 63 9e-11 ref|XP_007226950.1| hypothetical protein PRUPE_ppa025194mg, part... 63 9e-11 ref|XP_007220363.1| hypothetical protein PRUPE_ppa016496mg, part... 62 1e-10 >ref|XP_007203318.1| hypothetical protein PRUPE_ppa019964mg, partial [Prunus persica] gi|462398849|gb|EMJ04517.1| hypothetical protein PRUPE_ppa019964mg, partial [Prunus persica] Length = 1488 Score = 63.2 bits (152), Expect(2) = 9e-11 Identities = 27/55 (49%), Positives = 37/55 (67%) Frame = +3 Query: 39 KLELWVDWLESHFSVSKYTHKVKINFVCLKLDGYVIT*WKSYSKNNSIKEFTWKN 203 KL+ WVD LE++F+V KY++ KI F LKL + +T WKSY + + E TWKN Sbjct: 130 KLDNWVDTLETYFTVYKYSNVQKIKFASLKLSSHALTWWKSYQRRYDVSELTWKN 184 Score = 28.9 bits (63), Expect(2) = 9e-11 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = +2 Query: 197 EEFKRLVQK*FYSIEYLEERWH 262 + FK+L++K FY + Y +ERW+ Sbjct: 183 KNFKKLLRKQFYPVGYEDERWY 204 >ref|XP_007219137.1| hypothetical protein PRUPE_ppa015965mg [Prunus persica] gi|462415599|gb|EMJ20336.1| hypothetical protein PRUPE_ppa015965mg [Prunus persica] Length = 1484 Score = 63.2 bits (152), Expect(2) = 9e-11 Identities = 27/55 (49%), Positives = 37/55 (67%) Frame = +3 Query: 39 KLELWVDWLESHFSVSKYTHKVKINFVCLKLDGYVIT*WKSYSKNNSIKEFTWKN 203 KL+ WVD LE++F+V KY++ KI F LKL + +T WKSY + + E TWKN Sbjct: 140 KLDNWVDTLETYFTVYKYSNVQKIKFASLKLSSHALTWWKSYQRRYDVSELTWKN 194 Score = 28.9 bits (63), Expect(2) = 9e-11 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = +2 Query: 197 EEFKRLVQK*FYSIEYLEERWH 262 + FK+L++K FY + Y +ERW+ Sbjct: 193 KNFKKLLRKQFYPVGYEDERWY 214 >ref|XP_007224256.1| hypothetical protein PRUPE_ppa018408mg, partial [Prunus persica] gi|462421192|gb|EMJ25455.1| hypothetical protein PRUPE_ppa018408mg, partial [Prunus persica] Length = 1440 Score = 63.2 bits (152), Expect(2) = 9e-11 Identities = 27/55 (49%), Positives = 37/55 (67%) Frame = +3 Query: 39 KLELWVDWLESHFSVSKYTHKVKINFVCLKLDGYVIT*WKSYSKNNSIKEFTWKN 203 KL+ WVD LE++F+V KY++ KI F LKL + +T WKSY + + E TWKN Sbjct: 130 KLDNWVDTLETYFTVYKYSNVQKIKFASLKLSSHALTWWKSYQRRYDVSELTWKN 184 Score = 28.9 bits (63), Expect(2) = 9e-11 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = +2 Query: 197 EEFKRLVQK*FYSIEYLEERWH 262 + FK+L++K FY + Y +ERW+ Sbjct: 183 KNFKKLLRKQFYPVGYEDERWY 204 >ref|XP_007226950.1| hypothetical protein PRUPE_ppa025194mg, partial [Prunus persica] gi|462423886|gb|EMJ28149.1| hypothetical protein PRUPE_ppa025194mg, partial [Prunus persica] Length = 1347 Score = 63.2 bits (152), Expect(2) = 9e-11 Identities = 27/55 (49%), Positives = 37/55 (67%) Frame = +3 Query: 39 KLELWVDWLESHFSVSKYTHKVKINFVCLKLDGYVIT*WKSYSKNNSIKEFTWKN 203 KL+ WVD LE++F+V KY++ KI F LKL + +T WKSY + + E TWKN Sbjct: 59 KLDNWVDTLETYFTVYKYSNVQKIKFASLKLSSHALTWWKSYQRRYDVSELTWKN 113 Score = 28.9 bits (63), Expect(2) = 9e-11 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = +2 Query: 197 EEFKRLVQK*FYSIEYLEERWH 262 + FK+L++K FY + Y +ERW+ Sbjct: 112 KNFKKLLRKQFYPVGYEDERWY 133 >ref|XP_007220363.1| hypothetical protein PRUPE_ppa016496mg, partial [Prunus persica] gi|462416825|gb|EMJ21562.1| hypothetical protein PRUPE_ppa016496mg, partial [Prunus persica] Length = 373 Score = 62.4 bits (150), Expect(2) = 1e-10 Identities = 26/55 (47%), Positives = 37/55 (67%) Frame = +3 Query: 39 KLELWVDWLESHFSVSKYTHKVKINFVCLKLDGYVIT*WKSYSKNNSIKEFTWKN 203 KL+ WVD LE++F+V KY++ KI F +KL + +T WKSY + + E TWKN Sbjct: 18 KLDNWVDTLETYFTVYKYSNVQKIKFASMKLSSHALTWWKSYQRRYDVSELTWKN 72 Score = 28.9 bits (63), Expect(2) = 1e-10 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = +2 Query: 197 EEFKRLVQK*FYSIEYLEERWH 262 + FK+L++K FY + Y +ERW+ Sbjct: 71 KNFKKLLRKQFYPVGYEDERWY 92