BLASTX nr result
ID: Paeonia23_contig00043660
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00043660 (315 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588439.1| F-box protein [Medicago truncatula] gi|35547... 70 3e-10 ref|XP_003599239.1| F-box protein [Medicago truncatula] gi|35548... 68 1e-09 ref|XP_003599163.1| F-box protein [Medicago truncatula] gi|35548... 68 1e-09 gb|ACJ85062.1| unknown [Medicago truncatula] gi|388504026|gb|AFK... 68 1e-09 ref|XP_003599200.1| F-box protein [Medicago truncatula] gi|35548... 66 4e-09 ref|XP_003599176.1| F-box protein SKIP23 [Medicago truncatula] g... 65 1e-08 ref|XP_003599188.1| F-box protein [Medicago truncatula] gi|35548... 64 2e-08 ref|XP_006574655.1| PREDICTED: F-box protein SKIP23-like isoform... 64 2e-08 ref|XP_003608603.1| F-box protein [Medicago truncatula] gi|35550... 64 2e-08 ref|XP_003618744.1| F-box protein [Medicago truncatula] gi|35549... 64 2e-08 ref|XP_003599184.1| F-box protein [Medicago truncatula] gi|35548... 64 2e-08 ref|XP_003591727.1| F-box protein [Medicago truncatula] gi|35834... 64 2e-08 ref|XP_003602302.1| F-box family protein [Medicago truncatula] g... 64 3e-08 ref|XP_003589028.1| F-box protein SKIP23 [Medicago truncatula] g... 64 3e-08 ref|XP_003599161.1| F-box protein [Medicago truncatula] gi|35548... 64 3e-08 ref|XP_003599229.1| F-box protein [Medicago truncatula] gi|35548... 63 5e-08 ref|XP_003599179.1| F-box family protein [Medicago truncatula] g... 62 6e-08 gb|AFK40639.1| unknown [Medicago truncatula] 62 8e-08 ref|XP_003599164.1| F-box protein [Medicago truncatula] gi|35548... 62 8e-08 ref|XP_003599226.1| F-box protein [Medicago truncatula] gi|35548... 62 8e-08 >ref|XP_003588439.1| F-box protein [Medicago truncatula] gi|355477487|gb|AES58690.1| F-box protein [Medicago truncatula] Length = 397 Score = 70.1 bits (170), Expect = 3e-10 Identities = 42/96 (43%), Positives = 58/96 (60%), Gaps = 4/96 (4%) Frame = +2 Query: 20 PSSKEVSVIAFSFCYIGVLTLVTLVESSDDLLL--VYKMEYGA--DKCYFNVFKLDEEER 187 P V ++A S +G + LVES DLLL VY+ + A + NVFKL+E+E+ Sbjct: 251 PEDSTVQLVAQSL--VGGGDIKFLVESDSDLLLADVYQRRFDAPDEHIRINVFKLNEKEK 308 Query: 188 RWIKMKNLGDRVLFICNDCSFSVSARKYVEYKENCI 295 +W+K+ N+GDRVLF+ CSFSVSA K NC+ Sbjct: 309 KWVKLANIGDRVLFLGWLCSFSVSASDLCVRKRNCV 344 >ref|XP_003599239.1| F-box protein [Medicago truncatula] gi|355488287|gb|AES69490.1| F-box protein [Medicago truncatula] Length = 800 Score = 68.2 bits (165), Expect = 1e-09 Identities = 34/71 (47%), Positives = 48/71 (67%), Gaps = 2/71 (2%) Frame = +2 Query: 89 LVESSDDLLLV--YKMEYGADKCYFNVFKLDEEERRWIKMKNLGDRVLFICNDCSFSVSA 262 LV+S +LLLV ++ G D +VF+LDE+E++W+K+ NLGDRVLF+ DCSFS SA Sbjct: 306 LVKSEHELLLVDCNGIDAGDDDVSIDVFRLDEKEKKWVKLTNLGDRVLFLGEDCSFSASA 365 Query: 263 RKYVEYKENCI 295 + NC+ Sbjct: 366 SELCVANGNCV 376 >ref|XP_003599163.1| F-box protein [Medicago truncatula] gi|355488211|gb|AES69414.1| F-box protein [Medicago truncatula] Length = 401 Score = 68.2 bits (165), Expect = 1e-09 Identities = 35/70 (50%), Positives = 49/70 (70%), Gaps = 1/70 (1%) Frame = +2 Query: 89 LVESSD-DLLLVYKMEYGADKCYFNVFKLDEEERRWIKMKNLGDRVLFICNDCSFSVSAR 265 LVESS+ +LLLV + E + +VF+LDE+E+RW+K+ NLGD+VLF+ N CSFS SA Sbjct: 246 LVESSEFELLLVDRYENYCVPVWIDVFRLDEKEKRWVKLTNLGDKVLFLGNGCSFSASAS 305 Query: 266 KYVEYKENCI 295 + NC+ Sbjct: 306 ELGFANGNCV 315 >gb|ACJ85062.1| unknown [Medicago truncatula] gi|388504026|gb|AFK40079.1| unknown [Medicago truncatula] Length = 368 Score = 68.2 bits (165), Expect = 1e-09 Identities = 35/70 (50%), Positives = 49/70 (70%), Gaps = 1/70 (1%) Frame = +2 Query: 89 LVESSD-DLLLVYKMEYGADKCYFNVFKLDEEERRWIKMKNLGDRVLFICNDCSFSVSAR 265 LVESS+ +LLLV + E + +VF+LDE+E+RW+K+ NLGD+VLF+ N CSFS SA Sbjct: 246 LVESSEFELLLVDRYENYCVPVWIDVFRLDEKEKRWVKLTNLGDKVLFLGNGCSFSASAS 305 Query: 266 KYVEYKENCI 295 + NC+ Sbjct: 306 ELGFANGNCV 315 >ref|XP_003599200.1| F-box protein [Medicago truncatula] gi|355488248|gb|AES69451.1| F-box protein [Medicago truncatula] Length = 375 Score = 66.2 bits (160), Expect = 4e-09 Identities = 35/69 (50%), Positives = 42/69 (60%) Frame = +2 Query: 89 LVESSDDLLLVYKMEYGADKCYFNVFKLDEEERRWIKMKNLGDRVLFICNDCSFSVSARK 268 LVES DLLLV E NV +LDE+E RW+ + +LGDRVLF+ N CSFS SA Sbjct: 254 LVESDGDLLLVDVYESIGFDLMVNVLRLDEKEMRWVNLMSLGDRVLFLGNGCSFSASASD 313 Query: 269 YVEYKENCI 295 K NC+ Sbjct: 314 LCVSKGNCV 322 >ref|XP_003599176.1| F-box protein SKIP23 [Medicago truncatula] gi|355488224|gb|AES69427.1| F-box protein SKIP23 [Medicago truncatula] Length = 357 Score = 65.1 bits (157), Expect = 1e-08 Identities = 35/69 (50%), Positives = 44/69 (63%) Frame = +2 Query: 89 LVESSDDLLLVYKMEYGADKCYFNVFKLDEEERRWIKMKNLGDRVLFICNDCSFSVSARK 268 LVES LLLV E + F+VF+LDE+ +RW+K+ +LGDRVLF N CSFS SA Sbjct: 250 LVESEGALLLVNIYE---NLMNFDVFRLDEKNKRWVKLMSLGDRVLFFVNGCSFSASASD 306 Query: 269 YVEYKENCI 295 K NC+ Sbjct: 307 LCVAKGNCV 315 >ref|XP_003599188.1| F-box protein [Medicago truncatula] gi|355488236|gb|AES69439.1| F-box protein [Medicago truncatula] Length = 969 Score = 64.3 bits (155), Expect = 2e-08 Identities = 40/104 (38%), Positives = 56/104 (53%), Gaps = 6/104 (5%) Frame = +2 Query: 2 GAAMVDPSSKEVSVIAFSFCYIGVLTLVTLVESSDDLLLV-----YKMEY-GADKCYFNV 163 G M+ P V ++A G + LV+ DLLLV + E+ G D +V Sbjct: 224 GTFMIGPDDSNVHLVAEPLIDGGDIKF--LVDREGDLLLVDIYECFCFEFPGPDAIRVDV 281 Query: 164 FKLDEEERRWIKMKNLGDRVLFICNDCSFSVSARKYVEYKENCI 295 FKL E+E++W+K+ LGD VLF+ NDCSFS SA + NC+ Sbjct: 282 FKLYEKEKKWVKLTTLGDSVLFLGNDCSFSASASDLCLPRGNCV 325 >ref|XP_006574655.1| PREDICTED: F-box protein SKIP23-like isoform X1 [Glycine max] gi|571438728|ref|XP_006574656.1| PREDICTED: F-box protein SKIP23-like isoform X2 [Glycine max] Length = 379 Score = 63.9 bits (154), Expect = 2e-08 Identities = 42/110 (38%), Positives = 58/110 (52%), Gaps = 16/110 (14%) Frame = +2 Query: 14 VDPSSKEVSVIAFSFCYIGVLTLVTLVESSDDLLLV---YKMEYGADKCY---------- 154 +D SS + ++ FS G+ LVES L +V Y+ E + Y Sbjct: 229 IDTSS--LKLVQFSPPLCGLGDKKHLVESCGSLYVVDRYYESETSRRRNYVGGREDRVAA 286 Query: 155 ---FNVFKLDEEERRWIKMKNLGDRVLFICNDCSFSVSARKYVEYKENCI 295 F V+KLDEE +W+ +KNLGDR + N CSFSVSA++ Y+ENCI Sbjct: 287 VVCFKVYKLDEEWGKWVDVKNLGDRAFVLGNSCSFSVSAKELTGYQENCI 336 >ref|XP_003608603.1| F-box protein [Medicago truncatula] gi|355509658|gb|AES90800.1| F-box protein [Medicago truncatula] Length = 384 Score = 63.9 bits (154), Expect = 2e-08 Identities = 36/69 (52%), Positives = 46/69 (66%) Frame = +2 Query: 89 LVESSDDLLLVYKMEYGADKCYFNVFKLDEEERRWIKMKNLGDRVLFICNDCSFSVSARK 268 LVES DLLLV ++ +VF+LDE+ER+W+K+KNLGDRVLFI + SFS SA Sbjct: 262 LVESEGDLLLVDISDHDLT---VDVFRLDEKERKWVKIKNLGDRVLFIGLEYSFSASASD 318 Query: 269 YVEYKENCI 295 + NCI Sbjct: 319 LCVSEGNCI 327 >ref|XP_003618744.1| F-box protein [Medicago truncatula] gi|355493759|gb|AES74962.1| F-box protein [Medicago truncatula] Length = 403 Score = 63.9 bits (154), Expect = 2e-08 Identities = 34/71 (47%), Positives = 47/71 (66%), Gaps = 2/71 (2%) Frame = +2 Query: 89 LVESSDDLLL--VYKMEYGADKCYFNVFKLDEEERRWIKMKNLGDRVLFICNDCSFSVSA 262 L ES DLLL VY + D + ++FKL+E+E++W+K+ +LGDRVLF+ CSFSVSA Sbjct: 252 LAESKGDLLLADVYDPDLN-DSVWIDLFKLNEKEKKWVKLTSLGDRVLFLGEVCSFSVSA 310 Query: 263 RKYVEYKENCI 295 K NC+ Sbjct: 311 SDLCVAKGNCV 321 >ref|XP_003599184.1| F-box protein [Medicago truncatula] gi|355488232|gb|AES69435.1| F-box protein [Medicago truncatula] Length = 387 Score = 63.9 bits (154), Expect = 2e-08 Identities = 36/69 (52%), Positives = 46/69 (66%) Frame = +2 Query: 89 LVESSDDLLLVYKMEYGADKCYFNVFKLDEEERRWIKMKNLGDRVLFICNDCSFSVSARK 268 LVES DLLLV ++ +VF+LDE+ER+W+K+KNLGDRVLFI + SFS SA Sbjct: 262 LVESEGDLLLVDISDHDLT---VDVFRLDEKERKWVKIKNLGDRVLFIGLEYSFSASASD 318 Query: 269 YVEYKENCI 295 + NCI Sbjct: 319 LCVSEGNCI 327 >ref|XP_003591727.1| F-box protein [Medicago truncatula] gi|358344561|ref|XP_003636357.1| F-box protein [Medicago truncatula] gi|355480775|gb|AES61978.1| F-box protein [Medicago truncatula] gi|355502292|gb|AES83495.1| F-box protein [Medicago truncatula] Length = 404 Score = 63.9 bits (154), Expect = 2e-08 Identities = 39/101 (38%), Positives = 56/101 (55%), Gaps = 8/101 (7%) Frame = +2 Query: 17 DPSSKEVSVIAFSFCYIGVLTLVTLVESSDDLLLV--------YKMEYGADKCYFNVFKL 172 +P V ++A F + LVE+ DLLLV Y ++ A + Y VF+L Sbjct: 227 EPDDLTVQLVAEPFVDGAGGRVKFLVENEGDLLLVDIYEICLSYYLDEDALRIY--VFRL 284 Query: 173 DEEERRWIKMKNLGDRVLFICNDCSFSVSARKYVEYKENCI 295 DE+E++W+ + +LGDRVLF+ N CSFS SA K NC+ Sbjct: 285 DEKEKKWVSLTSLGDRVLFLGNGCSFSASASDLCVAKGNCV 325 >ref|XP_003602302.1| F-box family protein [Medicago truncatula] gi|355491350|gb|AES72553.1| F-box family protein [Medicago truncatula] Length = 434 Score = 63.5 bits (153), Expect = 3e-08 Identities = 34/76 (44%), Positives = 46/76 (60%), Gaps = 7/76 (9%) Frame = +2 Query: 89 LVESSDDLLLVYKMEY-------GADKCYFNVFKLDEEERRWIKMKNLGDRVLFICNDCS 247 LVES D LL+ + G D +VF+LDE+E++W+K+ +LGDRVLF+ N CS Sbjct: 276 LVESEGDQLLLVDIYDSHCFGFPGEDGLKLDVFRLDEKEKKWVKLASLGDRVLFLGNGCS 335 Query: 248 FSVSARKYVEYKENCI 295 FS SA K NC+ Sbjct: 336 FSASASDLSVVKGNCV 351 >ref|XP_003589028.1| F-box protein SKIP23 [Medicago truncatula] gi|355478076|gb|AES59279.1| F-box protein SKIP23 [Medicago truncatula] Length = 185 Score = 63.5 bits (153), Expect = 3e-08 Identities = 34/74 (45%), Positives = 45/74 (60%), Gaps = 5/74 (6%) Frame = +2 Query: 89 LVESSDDLLLVYKMEY-----GADKCYFNVFKLDEEERRWIKMKNLGDRVLFICNDCSFS 253 LVES LLLV E+ G + VF+LDE+ R+W+K+ +LGDRVLF+ N C FS Sbjct: 56 LVESEGKLLLVVIYEFLGFASGDSVFWIKVFRLDEKARKWVKLTSLGDRVLFLGNGCLFS 115 Query: 254 VSARKYVEYKENCI 295 SA + K NC+ Sbjct: 116 ASASELSVTKGNCV 129 >ref|XP_003599161.1| F-box protein [Medicago truncatula] gi|355488209|gb|AES69412.1| F-box protein [Medicago truncatula] Length = 377 Score = 63.5 bits (153), Expect = 3e-08 Identities = 34/70 (48%), Positives = 48/70 (68%), Gaps = 1/70 (1%) Frame = +2 Query: 89 LVESSD-DLLLVYKMEYGADKCYFNVFKLDEEERRWIKMKNLGDRVLFICNDCSFSVSAR 265 LVESS+ +LLLV + E + +VF+LDE+E+RW+K+ NLGD+VLF+ N SFS SA Sbjct: 255 LVESSEFELLLVDRYENYRVPVWIDVFRLDEKEKRWVKLANLGDKVLFLGNGYSFSASAS 314 Query: 266 KYVEYKENCI 295 + NC+ Sbjct: 315 ELGFANGNCV 324 >ref|XP_003599229.1| F-box protein [Medicago truncatula] gi|355488277|gb|AES69480.1| F-box protein [Medicago truncatula] Length = 392 Score = 62.8 bits (151), Expect = 5e-08 Identities = 34/72 (47%), Positives = 45/72 (62%), Gaps = 3/72 (4%) Frame = +2 Query: 89 LVESSDDLLLV---YKMEYGADKCYFNVFKLDEEERRWIKMKNLGDRVLFICNDCSFSVS 259 LVES +LLLV +++G NVF+ E+E++W+K+ NLGDRVLF+ CSFS S Sbjct: 278 LVESDGELLLVDIYESLDFG-----INVFRFHEKEKKWVKLMNLGDRVLFLGEGCSFSAS 332 Query: 260 ARKYVEYKENCI 295 A K NCI Sbjct: 333 ASDLCVSKGNCI 344 >ref|XP_003599179.1| F-box family protein [Medicago truncatula] gi|355488227|gb|AES69430.1| F-box family protein [Medicago truncatula] Length = 334 Score = 62.4 bits (150), Expect = 6e-08 Identities = 34/69 (49%), Positives = 44/69 (63%) Frame = +2 Query: 89 LVESSDDLLLVYKMEYGADKCYFNVFKLDEEERRWIKMKNLGDRVLFICNDCSFSVSARK 268 LVES +LLLV E + F+VF LDE+ ++W+K+ +LGDRVLF N CSFS SA Sbjct: 214 LVESEGELLLVNIYE---NLKTFDVFCLDEKNKKWVKLTSLGDRVLFFVNKCSFSASALD 270 Query: 269 YVEYKENCI 295 K NC+ Sbjct: 271 MCVTKGNCV 279 >gb|AFK40639.1| unknown [Medicago truncatula] Length = 368 Score = 62.0 bits (149), Expect = 8e-08 Identities = 33/70 (47%), Positives = 47/70 (67%), Gaps = 1/70 (1%) Frame = +2 Query: 89 LVESSD-DLLLVYKMEYGADKCYFNVFKLDEEERRWIKMKNLGDRVLFICNDCSFSVSAR 265 LVESS+ +LLLV + E + +VF+LDE+E+RW+K+ NLGD+ LF+ N SFS SA Sbjct: 246 LVESSEFELLLVDRYENYCVPVWIDVFRLDEKEKRWVKLTNLGDKALFLGNGRSFSASAS 305 Query: 266 KYVEYKENCI 295 + NC+ Sbjct: 306 ELGFANGNCV 315 >ref|XP_003599164.1| F-box protein [Medicago truncatula] gi|355488212|gb|AES69415.1| F-box protein [Medicago truncatula] Length = 752 Score = 62.0 bits (149), Expect = 8e-08 Identities = 34/75 (45%), Positives = 46/75 (61%), Gaps = 6/75 (8%) Frame = +2 Query: 89 LVESSDDLLLV-----YKMEY-GADKCYFNVFKLDEEERRWIKMKNLGDRVLFICNDCSF 250 LVE +LLLV + E+ G D +VFKLDE E++W+K+ LGD VLF+ N+CSF Sbjct: 238 LVEREGELLLVDIYECFCFEFPGPDAIRVDVFKLDEMEKKWVKLTTLGDSVLFLGNECSF 297 Query: 251 SVSARKYVEYKENCI 295 S SA + NC+ Sbjct: 298 SASASDLCVPRGNCV 312 >ref|XP_003599226.1| F-box protein [Medicago truncatula] gi|355488274|gb|AES69477.1| F-box protein [Medicago truncatula] Length = 357 Score = 62.0 bits (149), Expect = 8e-08 Identities = 34/72 (47%), Positives = 44/72 (61%), Gaps = 3/72 (4%) Frame = +2 Query: 89 LVESSDDLLLV---YKMEYGADKCYFNVFKLDEEERRWIKMKNLGDRVLFICNDCSFSVS 259 LVES +LLLV +++G NVF+ E+E++W+K+ NLGDRVLF CSFS S Sbjct: 243 LVESDGELLLVDIYESLDFG-----INVFRFHEKEKKWVKLMNLGDRVLFFGEGCSFSAS 297 Query: 260 ARKYVEYKENCI 295 A K NCI Sbjct: 298 ASDLCVSKGNCI 309