BLASTX nr result
ID: Paeonia23_contig00043651
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00043651 (256 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007296644.1| hypothetical protein MBM_08755 [Marssonina b... 72 6e-11 >ref|XP_007296644.1| hypothetical protein MBM_08755 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406859932|gb|EKD12993.1| hypothetical protein MBM_08755 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 594 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/44 (75%), Positives = 38/44 (86%) Frame = +2 Query: 125 ALLVTLPAAVRALSLSAYDLGFYGVYPTQNYPSLGNPSPWIQIS 256 ALL TLPAA RALS +AYDLGFYGVYPTQN+ SLG SPW++I+ Sbjct: 34 ALLATLPAAARALSFNAYDLGFYGVYPTQNHISLGQRSPWVRIT 77