BLASTX nr result
ID: Paeonia23_contig00043646
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00043646 (274 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006483347.1| PREDICTED: pentatricopeptide repeat-containi... 90 4e-16 ref|XP_006483346.1| PREDICTED: pentatricopeptide repeat-containi... 90 4e-16 ref|XP_006353692.1| PREDICTED: pentatricopeptide repeat-containi... 88 1e-15 ref|XP_004241773.1| PREDICTED: pentatricopeptide repeat-containi... 86 4e-15 ref|XP_002515531.1| pentatricopeptide repeat-containing protein,... 84 2e-14 ref|XP_004138859.1| PREDICTED: pentatricopeptide repeat-containi... 79 9e-13 ref|XP_002282605.2| PREDICTED: pentatricopeptide repeat-containi... 79 9e-13 gb|EXB96783.1| hypothetical protein L484_001891 [Morus notabilis] 78 1e-12 ref|XP_004291465.1| PREDICTED: pentatricopeptide repeat-containi... 75 9e-12 ref|XP_007161218.1| hypothetical protein PHAVU_001G0518000g, par... 75 1e-11 ref|XP_004498663.1| PREDICTED: pentatricopeptide repeat-containi... 74 2e-11 ref|XP_006601143.1| PREDICTED: pentatricopeptide repeat-containi... 72 6e-11 ref|XP_007011888.1| Tetratricopeptide repeat-like superfamily pr... 66 6e-09 ref|XP_003588753.1| Pentatricopeptide repeat-containing protein ... 65 7e-09 ref|XP_006450458.1| hypothetical protein CICLE_v10010438mg, part... 62 6e-08 >ref|XP_006483347.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like isoform X2 [Citrus sinensis] Length = 566 Score = 89.7 bits (221), Expect = 4e-16 Identities = 48/79 (60%), Positives = 58/79 (73%) Frame = -2 Query: 237 ALSLTATLQVPPKINSRAAEQNCLVLLEGCNNLQKLTQLQSLILKLGLQSNPLVLTKFTY 58 AL + LQ I+ RAAEQ+CL LL+ CN+L KL Q+ S ILKLGL +NPLVLTKFT Sbjct: 4 ALKAKSRLQCKIPIHDRAAEQSCLALLQSCNSLPKLAQIHSRILKLGLLNNPLVLTKFTA 63 Query: 57 TSSKLDAIDRAFSVVFSSD 1 TSS L+AID A SV+FS + Sbjct: 64 TSSDLNAIDYATSVIFSPE 82 >ref|XP_006483346.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like isoform X1 [Citrus sinensis] Length = 600 Score = 89.7 bits (221), Expect = 4e-16 Identities = 48/79 (60%), Positives = 58/79 (73%) Frame = -2 Query: 237 ALSLTATLQVPPKINSRAAEQNCLVLLEGCNNLQKLTQLQSLILKLGLQSNPLVLTKFTY 58 AL + LQ I+ RAAEQ+CL LL+ CN+L KL Q+ S ILKLGL +NPLVLTKFT Sbjct: 4 ALKAKSRLQCKIPIHDRAAEQSCLALLQSCNSLPKLAQIHSRILKLGLLNNPLVLTKFTA 63 Query: 57 TSSKLDAIDRAFSVVFSSD 1 TSS L+AID A SV+FS + Sbjct: 64 TSSDLNAIDYATSVIFSPE 82 >ref|XP_006353692.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Solanum tuberosum] Length = 605 Score = 88.2 bits (217), Expect = 1e-15 Identities = 54/88 (61%), Positives = 64/88 (72%), Gaps = 1/88 (1%) Frame = -2 Query: 267 TKSKLFRS-SDALSLTATLQVPPKINSRAAEQNCLVLLEGCNNLQKLTQLQSLILKLGLQ 91 +KSKLFRS +LSLT+ +RAAEQNCL LL+ C++L KL QLQS I KLGLQ Sbjct: 6 SKSKLFRSLHTSLSLTS--------KNRAAEQNCLSLLQLCDSLPKLLQLQSHIFKLGLQ 57 Query: 90 SNPLVLTKFTYTSSKLDAIDRAFSVVFS 7 SNPLVLTKFT SS+L+AI A S +FS Sbjct: 58 SNPLVLTKFTSISSELNAIAHASSFIFS 85 >ref|XP_004241773.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Solanum lycopersicum] Length = 607 Score = 86.3 bits (212), Expect = 4e-15 Identities = 54/90 (60%), Positives = 64/90 (71%), Gaps = 3/90 (3%) Frame = -2 Query: 267 TKSKLFRS---SDALSLTATLQVPPKINSRAAEQNCLVLLEGCNNLQKLTQLQSLILKLG 97 +KSKLF S S +LSLT+ +RAAEQNCL LL+ C++L KL QLQS I KLG Sbjct: 6 SKSKLFHSLHTSLSLSLTS--------KNRAAEQNCLSLLQLCDSLPKLLQLQSHIFKLG 57 Query: 96 LQSNPLVLTKFTYTSSKLDAIDRAFSVVFS 7 LQSNPLVLTKFT SS+L+AI A S +FS Sbjct: 58 LQSNPLVLTKFTSISSELNAIAHASSFIFS 87 >ref|XP_002515531.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223545475|gb|EEF46980.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 397 Score = 84.0 bits (206), Expect = 2e-14 Identities = 45/90 (50%), Positives = 59/90 (65%) Frame = -2 Query: 270 STKSKLFRSSDALSLTATLQVPPKINSRAAEQNCLVLLEGCNNLQKLTQLQSLILKLGLQ 91 + K++LFR+ ++T + N R AEQ CL LL+ CN KLTQ+ + ILKLGL Sbjct: 5 ANKTRLFRTVTESTITLASTIS---NKREAEQRCLSLLQDCNTFSKLTQIHTQILKLGLS 61 Query: 90 SNPLVLTKFTYTSSKLDAIDRAFSVVFSSD 1 +NPLVLTK+T TSS L AID A S +FS + Sbjct: 62 NNPLVLTKYTSTSSNLHAIDYASSFIFSPE 91 >ref|XP_004138859.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Cucumis sativus] gi|449529652|ref|XP_004171812.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Cucumis sativus] Length = 606 Score = 78.6 bits (192), Expect = 9e-13 Identities = 45/89 (50%), Positives = 58/89 (65%) Frame = -2 Query: 267 TKSKLFRSSDALSLTATLQVPPKINSRAAEQNCLVLLEGCNNLQKLTQLQSLILKLGLQS 88 TK KL R+ + + ++T N RA EQNCL LL+ CN L KLTQ+ + ILKLGL + Sbjct: 6 TKPKLLRTINNVLASSTP------NPRAPEQNCLALLQACNALPKLTQIHTHILKLGLHN 59 Query: 87 NPLVLTKFTYTSSKLDAIDRAFSVVFSSD 1 NPLVLTKF SS + A D A S +FS++ Sbjct: 60 NPLVLTKFASISSLIHATDYAASFLFSAE 88 >ref|XP_002282605.2| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Vitis vinifera] gi|296082021|emb|CBI21026.3| unnamed protein product [Vitis vinifera] Length = 583 Score = 78.6 bits (192), Expect = 9e-13 Identities = 40/64 (62%), Positives = 47/64 (73%) Frame = -2 Query: 198 INSRAAEQNCLVLLEGCNNLQKLTQLQSLILKLGLQSNPLVLTKFTYTSSKLDAIDRAFS 19 +N RA EQ CL +L+ CN L KL QL + I+KLG Q+NPLVLTKFT SS LDAI A S Sbjct: 1 MNHRAVEQPCLDILQACNTLPKLAQLHTHIIKLGFQNNPLVLTKFTSASSNLDAIPYAMS 60 Query: 18 VVFS 7 +VFS Sbjct: 61 LVFS 64 >gb|EXB96783.1| hypothetical protein L484_001891 [Morus notabilis] Length = 599 Score = 77.8 bits (190), Expect = 1e-12 Identities = 41/65 (63%), Positives = 49/65 (75%) Frame = -2 Query: 195 NSRAAEQNCLVLLEGCNNLQKLTQLQSLILKLGLQSNPLVLTKFTYTSSKLDAIDRAFSV 16 N RAAEQ+CL LLE C+ K QLQ+ ILKLGL++NPLVLTKF SS+L+A+D A S Sbjct: 17 NKRAAEQSCLSLLEACDARCKFVQLQAHILKLGLRNNPLVLTKFAAISSELNAVDYASSF 76 Query: 15 VFSSD 1 VFS D Sbjct: 77 VFSPD 81 >ref|XP_004291465.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Fragaria vesca subsp. vesca] Length = 588 Score = 75.1 bits (183), Expect = 9e-12 Identities = 38/66 (57%), Positives = 51/66 (77%) Frame = -2 Query: 198 INSRAAEQNCLVLLEGCNNLQKLTQLQSLILKLGLQSNPLVLTKFTYTSSKLDAIDRAFS 19 I +R AEQ+CL LL+ C+ + KL Q+Q+ I+KLGL++NPLVLTKF T+S L A+D A S Sbjct: 5 IKTREAEQSCLALLQICDVVSKLKQIQAHIVKLGLRNNPLVLTKFAATASDLKAVDYASS 64 Query: 18 VVFSSD 1 V+FS D Sbjct: 65 VLFSPD 70 >ref|XP_007161218.1| hypothetical protein PHAVU_001G0518000g, partial [Phaseolus vulgaris] gi|561034682|gb|ESW33212.1| hypothetical protein PHAVU_001G0518000g, partial [Phaseolus vulgaris] Length = 236 Score = 74.7 bits (182), Expect = 1e-11 Identities = 39/69 (56%), Positives = 45/69 (65%) Frame = -2 Query: 207 PPKINSRAAEQNCLVLLEGCNNLQKLTQLQSLILKLGLQSNPLVLTKFTYTSSKLDAIDR 28 P RAAEQ CL LL C+ L LT++ +LILKLGL NPLVLTKF T+S LDA+ Sbjct: 21 PDTTKRRAAEQTCLALLRTCHTLATLTRIHALILKLGLHHNPLVLTKFASTASDLDAVHY 80 Query: 27 AFSVVFSSD 1 A SV F D Sbjct: 81 AASVTFLDD 89 >ref|XP_004498663.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Cicer arietinum] Length = 609 Score = 74.3 bits (181), Expect = 2e-11 Identities = 42/79 (53%), Positives = 52/79 (65%), Gaps = 3/79 (3%) Frame = -2 Query: 228 LTATLQVPPKI-NSRAAEQNCLVLLEG--CNNLQKLTQLQSLILKLGLQSNPLVLTKFTY 58 L +T+Q+P SR AEQ CL LL CN KLTQ+Q+ ILK GLQ+NPL+LTKF Sbjct: 6 LLSTIQLPSNTPKSRLAEQTCLTLLHSSHCNTFTKLTQIQTFILKHGLQNNPLILTKFAS 65 Query: 57 TSSKLDAIDRAFSVVFSSD 1 TSS ++AI A S +F D Sbjct: 66 TSSNINAIHYASSFLFPFD 84 >ref|XP_006601143.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like isoform X1 [Glycine max] gi|571538394|ref|XP_006601144.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like isoform X2 [Glycine max] gi|571538398|ref|XP_006601145.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like isoform X3 [Glycine max] gi|571538402|ref|XP_006601146.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like isoform X4 [Glycine max] Length = 615 Score = 72.4 bits (176), Expect = 6e-11 Identities = 43/85 (50%), Positives = 51/85 (60%), Gaps = 3/85 (3%) Frame = -2 Query: 246 SSDALSLTATLQV---PPKINSRAAEQNCLVLLEGCNNLQKLTQLQSLILKLGLQSNPLV 76 SS A++ T QV P R AEQ L LL C+ L TQ+ SLILKLGL NPLV Sbjct: 7 SSSAITTTTFFQVHLPPHTTKRRVAEQTILSLLTTCDTLTTFTQIHSLILKLGLHHNPLV 66 Query: 75 LTKFTYTSSKLDAIDRAFSVVFSSD 1 LTKF TSS +A+ A SV+F +D Sbjct: 67 LTKFAATSSHFNAVHYASSVLFPND 91 >ref|XP_007011888.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] gi|508782251|gb|EOY29507.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] Length = 647 Score = 65.9 bits (159), Expect = 6e-09 Identities = 38/86 (44%), Positives = 51/86 (59%) Frame = -2 Query: 264 KSKLFRSSDALSLTATLQVPPKINSRAAEQNCLVLLEGCNNLQKLTQLQSLILKLGLQSN 85 K+KL +L+ +AT + AAE CL LL+ CN L Q+Q+ ILKLG Q+N Sbjct: 7 KTKLLILLRSLTTSATSSYYQRA---AAEHGCLTLLQSCNTFTNLLQIQTQILKLGFQNN 63 Query: 84 PLVLTKFTYTSSKLDAIDRAFSVVFS 7 PL+LT F SS L++ID A +FS Sbjct: 64 PLILTNFASKSSDLNSIDYAHCFLFS 89 >ref|XP_003588753.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355477801|gb|AES59004.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 600 Score = 65.5 bits (158), Expect = 7e-09 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 1/62 (1%) Frame = -2 Query: 192 SRAAEQNCLVLLEG-CNNLQKLTQLQSLILKLGLQSNPLVLTKFTYTSSKLDAIDRAFSV 16 +R EQ L LL CN L KLTQ+ + ILK GLQ+NPL+LTKFT TSS L++I A S Sbjct: 13 TRLTEQTILTLLNSHCNTLSKLTQIHAFILKTGLQNNPLILTKFTSTSSNLNSIHYATSF 72 Query: 15 VF 10 +F Sbjct: 73 LF 74 >ref|XP_006450458.1| hypothetical protein CICLE_v10010438mg, partial [Citrus clementina] gi|557553684|gb|ESR63698.1| hypothetical protein CICLE_v10010438mg, partial [Citrus clementina] Length = 629 Score = 62.4 bits (150), Expect = 6e-08 Identities = 33/50 (66%), Positives = 38/50 (76%) Frame = -2 Query: 150 CNNLQKLTQLQSLILKLGLQSNPLVLTKFTYTSSKLDAIDRAFSVVFSSD 1 C L KL Q+ S ILKLGL +NPLVLTKFT TSS L+AID A SV+FS + Sbjct: 62 CVGLPKLAQIHSRILKLGLLNNPLVLTKFTATSSDLNAIDYATSVIFSPE 111