BLASTX nr result
ID: Paeonia23_contig00043533
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00043533 (337 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007203318.1| hypothetical protein PRUPE_ppa019964mg, part... 48 5e-09 ref|XP_007224256.1| hypothetical protein PRUPE_ppa018408mg, part... 48 5e-09 ref|XP_007226950.1| hypothetical protein PRUPE_ppa025194mg, part... 48 5e-09 ref|XP_007220363.1| hypothetical protein PRUPE_ppa016496mg, part... 48 6e-09 ref|XP_007219137.1| hypothetical protein PRUPE_ppa015965mg [Prun... 48 2e-08 >ref|XP_007203318.1| hypothetical protein PRUPE_ppa019964mg, partial [Prunus persica] gi|462398849|gb|EMJ04517.1| hypothetical protein PRUPE_ppa019964mg, partial [Prunus persica] Length = 1488 Score = 47.8 bits (112), Expect(2) = 5e-09 Identities = 18/41 (43%), Positives = 29/41 (70%) Frame = -2 Query: 300 LVWRKNSKKSHNVKKMVRMTFVKRLRKQFYPIGYQAERWFR 178 L W K+ ++ ++V ++ F K LRKQFYP+GY+ ERW++ Sbjct: 165 LTWWKSYQRRYDVSELTWKNFKKLLRKQFYPVGYEDERWYK 205 Score = 38.1 bits (87), Expect(2) = 5e-09 Identities = 16/30 (53%), Positives = 21/30 (70%) Frame = -1 Query: 178 WQHLKHKRY*PVQEYTMEFHRKALVLKIDI 89 WQH + + VQEYT EFH +A+VL ID+ Sbjct: 206 WQHFRQRFGQHVQEYTTEFHNQAMVLDIDV 235 >ref|XP_007224256.1| hypothetical protein PRUPE_ppa018408mg, partial [Prunus persica] gi|462421192|gb|EMJ25455.1| hypothetical protein PRUPE_ppa018408mg, partial [Prunus persica] Length = 1440 Score = 47.8 bits (112), Expect(2) = 5e-09 Identities = 18/41 (43%), Positives = 29/41 (70%) Frame = -2 Query: 300 LVWRKNSKKSHNVKKMVRMTFVKRLRKQFYPIGYQAERWFR 178 L W K+ ++ ++V ++ F K LRKQFYP+GY+ ERW++ Sbjct: 165 LTWWKSYQRRYDVSELTWKNFKKLLRKQFYPVGYEDERWYK 205 Score = 38.1 bits (87), Expect(2) = 5e-09 Identities = 16/30 (53%), Positives = 21/30 (70%) Frame = -1 Query: 178 WQHLKHKRY*PVQEYTMEFHRKALVLKIDI 89 WQH + + VQEYT EFH +A+VL ID+ Sbjct: 206 WQHFRQRFGQHVQEYTTEFHNQAMVLDIDV 235 >ref|XP_007226950.1| hypothetical protein PRUPE_ppa025194mg, partial [Prunus persica] gi|462423886|gb|EMJ28149.1| hypothetical protein PRUPE_ppa025194mg, partial [Prunus persica] Length = 1347 Score = 47.8 bits (112), Expect(2) = 5e-09 Identities = 18/41 (43%), Positives = 29/41 (70%) Frame = -2 Query: 300 LVWRKNSKKSHNVKKMVRMTFVKRLRKQFYPIGYQAERWFR 178 L W K+ ++ ++V ++ F K LRKQFYP+GY+ ERW++ Sbjct: 94 LTWWKSYQRRYDVSELTWKNFKKLLRKQFYPVGYEDERWYK 134 Score = 38.1 bits (87), Expect(2) = 5e-09 Identities = 16/30 (53%), Positives = 21/30 (70%) Frame = -1 Query: 178 WQHLKHKRY*PVQEYTMEFHRKALVLKIDI 89 WQH + + VQEYT EFH +A+VL ID+ Sbjct: 135 WQHFRQRFGQHVQEYTTEFHNQAMVLDIDV 164 >ref|XP_007220363.1| hypothetical protein PRUPE_ppa016496mg, partial [Prunus persica] gi|462416825|gb|EMJ21562.1| hypothetical protein PRUPE_ppa016496mg, partial [Prunus persica] Length = 373 Score = 47.8 bits (112), Expect(2) = 6e-09 Identities = 18/41 (43%), Positives = 29/41 (70%) Frame = -2 Query: 300 LVWRKNSKKSHNVKKMVRMTFVKRLRKQFYPIGYQAERWFR 178 L W K+ ++ ++V ++ F K LRKQFYP+GY+ ERW++ Sbjct: 53 LTWWKSYQRRYDVSELTWKNFKKLLRKQFYPVGYEDERWYK 93 Score = 38.1 bits (87), Expect(2) = 6e-09 Identities = 16/30 (53%), Positives = 21/30 (70%) Frame = -1 Query: 178 WQHLKHKRY*PVQEYTMEFHRKALVLKIDI 89 WQH + + VQEYT EFH +A+VL ID+ Sbjct: 94 WQHFRQRFGQHVQEYTTEFHNQAMVLDIDV 123 >ref|XP_007219137.1| hypothetical protein PRUPE_ppa015965mg [Prunus persica] gi|462415599|gb|EMJ20336.1| hypothetical protein PRUPE_ppa015965mg [Prunus persica] Length = 1484 Score = 47.8 bits (112), Expect(2) = 2e-08 Identities = 18/41 (43%), Positives = 29/41 (70%) Frame = -2 Query: 300 LVWRKNSKKSHNVKKMVRMTFVKRLRKQFYPIGYQAERWFR 178 L W K+ ++ ++V ++ F K LRKQFYP+GY+ ERW++ Sbjct: 175 LTWWKSYQRRYDVSELTWKNFKKLLRKQFYPVGYEDERWYK 215 Score = 36.6 bits (83), Expect(2) = 2e-08 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = -1 Query: 178 WQHLKHKRY*PVQEYTMEFHRKALVLKIDI 89 WQH + + VQEYT +FH +A+VL ID+ Sbjct: 216 WQHFRQRFGQHVQEYTTKFHNQAMVLDIDV 245