BLASTX nr result
ID: Paeonia23_contig00043501
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00043501 (331 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006359508.1| PREDICTED: uncharacterized protein LOC102583... 71 1e-10 ref|XP_004242725.1| PREDICTED: uncharacterized protein LOC101256... 71 1e-10 ref|XP_002532312.1| heat shock protein 70 (HSP70)-interacting pr... 71 2e-10 ref|XP_004287246.1| PREDICTED: uncharacterized protein LOC101299... 70 3e-10 gb|EXC26519.1| Protein unc-45-A-like protein [Morus notabilis] 70 4e-10 ref|XP_002262977.2| PREDICTED: uncharacterized protein LOC100248... 69 7e-10 emb|CBI25567.3| unnamed protein product [Vitis vinifera] 69 7e-10 gb|EYU34944.1| hypothetical protein MIMGU_mgv1a002441mg [Mimulus... 67 3e-09 ref|XP_007013625.1| Octicosapeptide/Phox/Bem1p domain-containing... 67 3e-09 ref|XP_007204258.1| hypothetical protein PRUPE_ppa001968mg [Prun... 67 3e-09 ref|XP_006483417.1| PREDICTED: uncharacterized protein LOC102611... 66 4e-09 ref|XP_006453128.1| hypothetical protein CICLE_v10007599mg [Citr... 66 4e-09 ref|XP_006450352.1| hypothetical protein CICLE_v10007597mg [Citr... 66 4e-09 ref|XP_004146713.1| PREDICTED: uncharacterized protein LOC101217... 66 6e-09 ref|NP_001061478.2| Os08g0296900 [Oryza sativa Japonica Group] g... 66 6e-09 dbj|BAI39875.1| putative tetratricopeptide repeat domain 1 [Oryz... 66 6e-09 gb|EAZ06447.1| hypothetical protein OsI_28685 [Oryza sativa Indi... 66 6e-09 ref|XP_006600721.1| PREDICTED: uncharacterized protein LOC100778... 65 8e-09 ref|XP_004508413.1| PREDICTED: uncharacterized protein LOC101510... 65 8e-09 ref|XP_007225509.1| hypothetical protein PRUPE_ppa000461mg [Prun... 65 8e-09 >ref|XP_006359508.1| PREDICTED: uncharacterized protein LOC102583348 [Solanum tuberosum] Length = 780 Score = 71.2 bits (173), Expect = 1e-10 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -2 Query: 330 AWNEMYEARKWHSGIPSFRLEPLLRRRVSKLYHMLEQA 217 AWNEMYEA++W G+PSFRLEPLLRRRVSKLYH LE A Sbjct: 743 AWNEMYEAKRWERGVPSFRLEPLLRRRVSKLYHALELA 780 >ref|XP_004242725.1| PREDICTED: uncharacterized protein LOC101256392 [Solanum lycopersicum] Length = 778 Score = 71.2 bits (173), Expect = 1e-10 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -2 Query: 330 AWNEMYEARKWHSGIPSFRLEPLLRRRVSKLYHMLEQA 217 AWNEMYEA++W G+PSFRLEPLLRRRVSKLYH LE A Sbjct: 741 AWNEMYEAKRWERGVPSFRLEPLLRRRVSKLYHALELA 778 >ref|XP_002532312.1| heat shock protein 70 (HSP70)-interacting protein, putative [Ricinus communis] gi|223527981|gb|EEF30064.1| heat shock protein 70 (HSP70)-interacting protein, putative [Ricinus communis] Length = 709 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -2 Query: 330 AWNEMYEARKWHSGIPSFRLEPLLRRRVSKLYHMLE 223 AWNEMYEA+KW SG+PSFRLEPLLRRRVSKLY+ LE Sbjct: 672 AWNEMYEAKKWQSGVPSFRLEPLLRRRVSKLYNALE 707 >ref|XP_004287246.1| PREDICTED: uncharacterized protein LOC101299611 [Fragaria vesca subsp. vesca] Length = 741 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -2 Query: 330 AWNEMYEARKWHSGIPSFRLEPLLRRRVSKLYHMLEQA 217 AWNEMYEA+KW SGIPSFRLEPLLRRRVSKL+ LE A Sbjct: 698 AWNEMYEAKKWQSGIPSFRLEPLLRRRVSKLHSALENA 735 >gb|EXC26519.1| Protein unc-45-A-like protein [Morus notabilis] Length = 711 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -2 Query: 330 AWNEMYEARKWHSGIPSFRLEPLLRRRVSKLYHMLEQA 217 AWNEMYEA+KW SG+ SFRLEPLLRRRVSKLY+ LE A Sbjct: 674 AWNEMYEAKKWQSGVQSFRLEPLLRRRVSKLYYALEHA 711 >ref|XP_002262977.2| PREDICTED: uncharacterized protein LOC100248831 [Vitis vinifera] Length = 714 Score = 68.9 bits (167), Expect = 7e-10 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -2 Query: 330 AWNEMYEARKWHSGIPSFRLEPLLRRRVSKLYHMLE 223 AWNEMYEA++W SG+PSFRLEPL RRRV KLYH LE Sbjct: 677 AWNEMYEAKRWQSGVPSFRLEPLFRRRVPKLYHALE 712 >emb|CBI25567.3| unnamed protein product [Vitis vinifera] Length = 660 Score = 68.9 bits (167), Expect = 7e-10 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -2 Query: 330 AWNEMYEARKWHSGIPSFRLEPLLRRRVSKLYHMLE 223 AWNEMYEA++W SG+PSFRLEPL RRRV KLYH LE Sbjct: 623 AWNEMYEAKRWQSGVPSFRLEPLFRRRVPKLYHALE 658 >gb|EYU34944.1| hypothetical protein MIMGU_mgv1a002441mg [Mimulus guttatus] Length = 675 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -2 Query: 330 AWNEMYEARKWHSGIPSFRLEPLLRRRVSKLYHMLEQA 217 AWNEMYEA+KW + I SFRLEPLLRRRVSKLY+ LE A Sbjct: 638 AWNEMYEAKKWQTNISSFRLEPLLRRRVSKLYYALESA 675 >ref|XP_007013625.1| Octicosapeptide/Phox/Bem1p domain-containing protein / tetratricopeptide repeat-containing protein [Theobroma cacao] gi|508783988|gb|EOY31244.1| Octicosapeptide/Phox/Bem1p domain-containing protein / tetratricopeptide repeat-containing protein [Theobroma cacao] Length = 712 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = -2 Query: 330 AWNEMYEARKWHSGIPSFRLEPLLRRRVSKLYHMLEQA 217 AWNEMYEA+K S IPSFRLEPLLRRRVSK+YH LE A Sbjct: 675 AWNEMYEAKKCQSKIPSFRLEPLLRRRVSKIYHALEHA 712 >ref|XP_007204258.1| hypothetical protein PRUPE_ppa001968mg [Prunus persica] gi|462399789|gb|EMJ05457.1| hypothetical protein PRUPE_ppa001968mg [Prunus persica] Length = 734 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = -2 Query: 330 AWNEMYEARKWHSGIPSFRLEPLLRRRVSKLYHMLEQA 217 AWNEM+EA+KW SGIPSFRLEPLLRRR S++Y+ L+ A Sbjct: 697 AWNEMHEAKKWQSGIPSFRLEPLLRRRASRIYYALDHA 734 >ref|XP_006483417.1| PREDICTED: uncharacterized protein LOC102611694 isoform X1 [Citrus sinensis] gi|568859795|ref|XP_006483418.1| PREDICTED: uncharacterized protein LOC102611694 isoform X2 [Citrus sinensis] gi|568859797|ref|XP_006483419.1| PREDICTED: uncharacterized protein LOC102611694 isoform X3 [Citrus sinensis] Length = 720 Score = 66.2 bits (160), Expect = 4e-09 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -2 Query: 330 AWNEMYEARKWHSGIPSFRLEPLLRRRVSKLYHMLE 223 AWNEMY+A++W G+PSFRLEPL RRRV KLYH+LE Sbjct: 683 AWNEMYDAKRWQIGVPSFRLEPLFRRRVPKLYHILE 718 >ref|XP_006453128.1| hypothetical protein CICLE_v10007599mg [Citrus clementina] gi|568840840|ref|XP_006474373.1| PREDICTED: uncharacterized protein LOC102608895 isoform X1 [Citrus sinensis] gi|568840842|ref|XP_006474374.1| PREDICTED: uncharacterized protein LOC102608895 isoform X2 [Citrus sinensis] gi|568840844|ref|XP_006474375.1| PREDICTED: uncharacterized protein LOC102608895 isoform X3 [Citrus sinensis] gi|557556354|gb|ESR66368.1| hypothetical protein CICLE_v10007599mg [Citrus clementina] Length = 719 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = -2 Query: 330 AWNEMYEARKWHSGIPSFRLEPLLRRRVSKLYHMLEQA 217 AWN+MY A+KW SG+ S RLEPLLRRRVSKLYH LE A Sbjct: 682 AWNDMYAAKKWESGVSSLRLEPLLRRRVSKLYHALEHA 719 >ref|XP_006450352.1| hypothetical protein CICLE_v10007597mg [Citrus clementina] gi|567916694|ref|XP_006450353.1| hypothetical protein CICLE_v10007597mg [Citrus clementina] gi|557553578|gb|ESR63592.1| hypothetical protein CICLE_v10007597mg [Citrus clementina] gi|557553579|gb|ESR63593.1| hypothetical protein CICLE_v10007597mg [Citrus clementina] Length = 720 Score = 66.2 bits (160), Expect = 4e-09 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -2 Query: 330 AWNEMYEARKWHSGIPSFRLEPLLRRRVSKLYHMLE 223 AWNEMY+A++W G+PSFRLEPL RRRV KLYH+LE Sbjct: 683 AWNEMYDAKRWQIGVPSFRLEPLFRRRVPKLYHILE 718 >ref|XP_004146713.1| PREDICTED: uncharacterized protein LOC101217675 [Cucumis sativus] gi|449522602|ref|XP_004168315.1| PREDICTED: uncharacterized LOC101217675 [Cucumis sativus] Length = 711 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -2 Query: 330 AWNEMYEARKWHSGIPSFRLEPLLRRRVSKLYHMLE 223 AWNEMYEARK +G+PSFRLEPL RRRVSK+YH+LE Sbjct: 676 AWNEMYEARKLLTGVPSFRLEPLFRRRVSKIYHVLE 711 >ref|NP_001061478.2| Os08g0296900 [Oryza sativa Japonica Group] gi|50508716|dbj|BAD31284.1| putative octicosapeptide/Phox/Bem1p (PB1) domain-/tetratricopeptide repeat (TPR)-containing protein [Oryza sativa Japonica Group] gi|215707101|dbj|BAG93561.1| unnamed protein product [Oryza sativa Japonica Group] gi|255678333|dbj|BAF23392.2| Os08g0296900 [Oryza sativa Japonica Group] Length = 774 Score = 65.9 bits (159), Expect = 6e-09 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -2 Query: 330 AWNEMYEARKWHSGIPSFRLEPLLRRRVSKLYHMLE 223 AWNEMY+A+KW +G+PSFRLEP+ RRR KL+HMLE Sbjct: 734 AWNEMYDAKKWRNGVPSFRLEPIFRRRAPKLHHMLE 769 >dbj|BAI39875.1| putative tetratricopeptide repeat domain 1 [Oryza sativa Indica Group] Length = 775 Score = 65.9 bits (159), Expect = 6e-09 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -2 Query: 330 AWNEMYEARKWHSGIPSFRLEPLLRRRVSKLYHMLE 223 AWNEMY+A+KW +G+PSFRLEP+ RRR KL+HMLE Sbjct: 735 AWNEMYDAKKWRNGVPSFRLEPIFRRRAPKLHHMLE 770 >gb|EAZ06447.1| hypothetical protein OsI_28685 [Oryza sativa Indica Group] Length = 774 Score = 65.9 bits (159), Expect = 6e-09 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -2 Query: 330 AWNEMYEARKWHSGIPSFRLEPLLRRRVSKLYHMLE 223 AWNEMY+A+KW +G+PSFRLEP+ RRR KL+HMLE Sbjct: 734 AWNEMYDAKKWRNGVPSFRLEPIFRRRAPKLHHMLE 769 >ref|XP_006600721.1| PREDICTED: uncharacterized protein LOC100778972 isoform X2 [Glycine max] Length = 698 Score = 65.5 bits (158), Expect = 8e-09 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = -2 Query: 330 AWNEMYEARKWHSGIPSFRLEPLLRRRVSKLYHMLEQA 217 AWNEMY+A+KW S +PSFRLEPL RRRVSK YH E A Sbjct: 661 AWNEMYKAKKWQSAVPSFRLEPLFRRRVSKTYHAFELA 698 >ref|XP_004508413.1| PREDICTED: uncharacterized protein LOC101510959 [Cicer arietinum] Length = 726 Score = 65.5 bits (158), Expect = 8e-09 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -2 Query: 330 AWNEMYEARKWHSGIPSFRLEPLLRRRVSKLYHMLE 223 AWNEMY+A+KWH G+PSFRLEPL RRRVS++Y E Sbjct: 689 AWNEMYKAKKWHDGVPSFRLEPLFRRRVSRIYRAFE 724 >ref|XP_007225509.1| hypothetical protein PRUPE_ppa000461mg [Prunus persica] gi|462422445|gb|EMJ26708.1| hypothetical protein PRUPE_ppa000461mg [Prunus persica] Length = 1155 Score = 65.5 bits (158), Expect = 8e-09 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -2 Query: 330 AWNEMYEARKWHSGIPSFRLEPLLRRRVSKLYHMLEQA 217 AWNEMY+A++W G+PSFRLEPLLRRRV KL+ MLE A Sbjct: 1118 AWNEMYDAKRWQFGVPSFRLEPLLRRRVPKLHSMLEHA 1155