BLASTX nr result
ID: Paeonia23_contig00043338
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00043338 (274 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007147813.1| hypothetical protein PHAVU_006G157000g [Phas... 58 1e-06 ref|XP_003599631.1| F-box [Medicago truncatula] gi|357458723|ref... 57 2e-06 ref|NP_001241466.1| uncharacterized protein LOC100815072 [Glycin... 57 3e-06 ref|XP_004304889.1| PREDICTED: F-box/kelch-repeat protein At3g06... 56 6e-06 >ref|XP_007147813.1| hypothetical protein PHAVU_006G157000g [Phaseolus vulgaris] gi|561021036|gb|ESW19807.1| hypothetical protein PHAVU_006G157000g [Phaseolus vulgaris] Length = 410 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +1 Query: 151 ARLPVKSLLRFKCVRQSWHSKISDPRFVKKHLHLAT 258 +RLPVKSLL+F+CV +SW S ISDP F+KKHLHL+T Sbjct: 64 SRLPVKSLLQFRCVCKSWMSLISDPYFMKKHLHLST 99 >ref|XP_003599631.1| F-box [Medicago truncatula] gi|357458723|ref|XP_003599642.1| F-box [Medicago truncatula] gi|355488679|gb|AES69882.1| F-box [Medicago truncatula] gi|355488690|gb|AES69893.1| F-box [Medicago truncatula] Length = 350 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +1 Query: 154 RLPVKSLLRFKCVRQSWHSKISDPRFVKKHLHLAT 258 RLPVKSLL+F+CV +SW S ISDP+F KKHLH+ T Sbjct: 31 RLPVKSLLQFRCVCKSWKSLISDPKFAKKHLHMFT 65 >ref|NP_001241466.1| uncharacterized protein LOC100815072 [Glycine max] gi|255637050|gb|ACU18857.1| unknown [Glycine max] Length = 406 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = +1 Query: 151 ARLPVKSLLRFKCVRQSWHSKISDPRFVKKHLHLAT 258 +RLPVKSLL+F+CV +SW S ISDP F+KKHLHL++ Sbjct: 59 SRLPVKSLLQFRCVCKSWMSLISDPYFMKKHLHLSS 94 >ref|XP_004304889.1| PREDICTED: F-box/kelch-repeat protein At3g06240-like [Fragaria vesca subsp. vesca] Length = 414 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/33 (63%), Positives = 30/33 (90%) Frame = +1 Query: 151 ARLPVKSLLRFKCVRQSWHSKISDPRFVKKHLH 249 +RLP KSL+RFKC+R+SW++ I+DP+F+ KHLH Sbjct: 17 SRLPPKSLMRFKCIRKSWYALINDPKFIDKHLH 49