BLASTX nr result
ID: Paeonia23_contig00043161
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00043161 (329 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAD08951.1| putative reverse transcriptase [Arabidopsis thali... 57 2e-06 >gb|AAD08951.1| putative reverse transcriptase [Arabidopsis thaliana] gi|20197043|gb|AAM14892.1| putative reverse transcriptase [Arabidopsis thaliana] Length = 1412 Score = 57.4 bits (137), Expect = 2e-06 Identities = 41/101 (40%), Positives = 51/101 (50%), Gaps = 11/101 (10%) Frame = -1 Query: 329 PISCCNVVYKCIFKLLASILKPLL*SFINLT*SAFEMDSGQYPGLTRDS--------SHL 174 PISCCNV+YK I KLLA+ LK LL FI SAF D L S L Sbjct: 797 PISCCNVLYKAISKLLANRLKCLLPEFIAPNQSAFISDRLLMENLLLASELVKDYHKDGL 856 Query: 173 PPQ---SWPTKKANDSISWQFILDVLSVLEIPSQLIRCMRL 60 P+ KA DS+ W F+L+ L+ L+IP + I + L Sbjct: 857 SPRCAMKIDLSKAFDSVQWPFLLNTLAALDIPEKFIHWINL 897