BLASTX nr result
ID: Paeonia23_contig00042987
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00042987 (245 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007225607.1| hypothetical protein PRUPE_ppb013332mg [Prun... 46 1e-09 ref|XP_007221712.1| hypothetical protein PRUPE_ppb014385mg, part... 44 2e-08 ref|XP_006493642.1| PREDICTED: disease resistance protein At4g27... 40 5e-07 >ref|XP_007225607.1| hypothetical protein PRUPE_ppb013332mg [Prunus persica] gi|462422543|gb|EMJ26806.1| hypothetical protein PRUPE_ppb013332mg [Prunus persica] Length = 198 Score = 46.2 bits (108), Expect(2) = 1e-09 Identities = 23/34 (67%), Positives = 26/34 (76%) Frame = -3 Query: 210 QIRISRFEKVISIKLQSLW*EFDNL*MKENELVQ 109 +I +KVISIKLQSLW EFDNL MKENE +Q Sbjct: 108 KIEFQGSQKVISIKLQSLWREFDNLLMKENESIQ 141 Score = 42.0 bits (97), Expect(2) = 1e-09 Identities = 20/30 (66%), Positives = 24/30 (80%) Frame = -2 Query: 94 RVSGIFNQIRGYGDTIQEKRIVEIFLRSLP 5 ++SGI NQIR +GDTI K+IVE LRSLP Sbjct: 146 KISGIVNQIRSHGDTIPYKKIVEKTLRSLP 175 >ref|XP_007221712.1| hypothetical protein PRUPE_ppb014385mg, partial [Prunus persica] gi|462418648|gb|EMJ22911.1| hypothetical protein PRUPE_ppb014385mg, partial [Prunus persica] Length = 191 Score = 43.5 bits (101), Expect(2) = 2e-08 Identities = 21/30 (70%), Positives = 25/30 (83%) Frame = -2 Query: 94 RVSGIFNQIRGYGDTIQEKRIVEIFLRSLP 5 +VSGI NQI+ YGDTI +K+IVE LRSLP Sbjct: 31 KVSGIVNQIKCYGDTIPDKKIVEKTLRSLP 60 Score = 40.8 bits (94), Expect(2) = 2e-08 Identities = 20/26 (76%), Positives = 22/26 (84%) Frame = -3 Query: 186 KVISIKLQSLW*EFDNL*MKENELVQ 109 KVISIKLQSLW EFDNL MK++E Q Sbjct: 1 KVISIKLQSLWREFDNLLMKDSESTQ 26 >ref|XP_006493642.1| PREDICTED: disease resistance protein At4g27190-like [Citrus sinensis] Length = 1158 Score = 39.7 bits (91), Expect(3) = 5e-07 Identities = 18/28 (64%), Positives = 24/28 (85%) Frame = -3 Query: 189 EKVISIKLQSLW*EFDNL*MKENELVQN 106 EK ++IKLQ+LW EFDNL MK++E VQ+ Sbjct: 715 EKAVTIKLQTLWKEFDNLSMKDSEGVQD 742 Score = 35.8 bits (81), Expect(3) = 5e-07 Identities = 16/31 (51%), Positives = 24/31 (77%) Frame = -2 Query: 94 RVSGIFNQIRGYGDTIQEKRIVEIFLRSLPA 2 RV+ I NQI+G GD+I++K++ E LR LP+ Sbjct: 746 RVTEIVNQIKGCGDSIEDKKVNEKVLRCLPS 776 Score = 22.7 bits (47), Expect(3) = 5e-07 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = -1 Query: 236 KSKVA*DILKLEYQGSKR 183 K+K A +ILK E+QGS++ Sbjct: 699 KAKNAWEILKQEFQGSEK 716