BLASTX nr result
ID: Paeonia23_contig00042669
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00042669 (232 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003631786.1| PREDICTED: pentatricopeptide repeat-containi... 79 9e-13 emb|CAN63320.1| hypothetical protein VITISV_026425 [Vitis vinifera] 79 9e-13 ref|XP_007013742.1| Pentatricopeptide repeat-containing protein ... 74 2e-11 ref|XP_007013741.1| Pentatricopeptide repeat-containing protein ... 74 2e-11 ref|XP_002516609.1| pentatricopeptide repeat-containing protein,... 68 1e-09 gb|EYU21910.1| hypothetical protein MIMGU_mgv1a021056mg, partial... 66 6e-09 ref|XP_007224863.1| hypothetical protein PRUPE_ppa022809mg [Prun... 61 2e-07 >ref|XP_003631786.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, mitochondrial-like [Vitis vinifera] Length = 629 Score = 78.6 bits (192), Expect = 9e-13 Identities = 35/60 (58%), Positives = 46/60 (76%) Frame = +3 Query: 3 LEHLNRFNWVVNGPDMVSFNTLLAAACKRGNSSMVHRIWCIMEYAGLELNVISFTCLNQY 182 L+ + F W N PD+VSFNT+L+AACK+GNSSM+ R+ MEY G++LNV+S TCL QY Sbjct: 345 LQLFDHFEWANNSPDVVSFNTILSAACKQGNSSMIRRVLYRMEYEGVKLNVVSSTCLIQY 404 >emb|CAN63320.1| hypothetical protein VITISV_026425 [Vitis vinifera] Length = 722 Score = 78.6 bits (192), Expect = 9e-13 Identities = 35/60 (58%), Positives = 46/60 (76%) Frame = +3 Query: 3 LEHLNRFNWVVNGPDMVSFNTLLAAACKRGNSSMVHRIWCIMEYAGLELNVISFTCLNQY 182 L+ + F W N PD+VSFNT+L+AACK+GNSSM+ R+ MEY G++LNV+S TCL QY Sbjct: 453 LQLFDHFEWANNSPDVVSFNTILSAACKQGNSSMIRRVLYRMEYEGVKLNVVSSTCLIQY 512 >ref|XP_007013742.1| Pentatricopeptide repeat-containing protein isoform 2 [Theobroma cacao] gi|508784105|gb|EOY31361.1| Pentatricopeptide repeat-containing protein isoform 2 [Theobroma cacao] Length = 720 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/60 (55%), Positives = 44/60 (73%) Frame = +3 Query: 3 LEHLNRFNWVVNGPDMVSFNTLLAAACKRGNSSMVHRIWCIMEYAGLELNVISFTCLNQY 182 LE L+ F W NGPD+VSFNT+L+ AC+ GNS+++ I C MEY ++L+V S TCL QY Sbjct: 454 LELLDHFEWDANGPDVVSFNTILSTACRLGNSAIIQSILCRMEYEHIKLDVFSLTCLIQY 513 >ref|XP_007013741.1| Pentatricopeptide repeat-containing protein isoform 1 [Theobroma cacao] gi|508784104|gb|EOY31360.1| Pentatricopeptide repeat-containing protein isoform 1 [Theobroma cacao] Length = 761 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/60 (55%), Positives = 44/60 (73%) Frame = +3 Query: 3 LEHLNRFNWVVNGPDMVSFNTLLAAACKRGNSSMVHRIWCIMEYAGLELNVISFTCLNQY 182 LE L+ F W NGPD+VSFNT+L+ AC+ GNS+++ I C MEY ++L+V S TCL QY Sbjct: 454 LELLDHFEWDANGPDVVSFNTILSTACRLGNSAIIQSILCRMEYEHIKLDVFSLTCLIQY 513 >ref|XP_002516609.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223544429|gb|EEF45950.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 463 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/60 (53%), Positives = 43/60 (71%) Frame = +3 Query: 3 LEHLNRFNWVVNGPDMVSFNTLLAAACKRGNSSMVHRIWCIMEYAGLELNVISFTCLNQY 182 LE L+ F W NGPD+VSFNT+L ACK+GNS M+ +I MEY G++ +++S T L QY Sbjct: 344 LELLDHFKWGTNGPDVVSFNTILFMACKQGNSVMIQKILHRMEYEGIKPDIVSSTFLIQY 403 >gb|EYU21910.1| hypothetical protein MIMGU_mgv1a021056mg, partial [Mimulus guttatus] Length = 588 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/61 (52%), Positives = 44/61 (72%), Gaps = 1/61 (1%) Frame = +3 Query: 3 LEHLNRFNWVVNGPDMVSFNTLLAAACKRGNSSMVHRIWCIM-EYAGLELNVISFTCLNQ 179 LE LN W GPD+VSFNT+L+AAC+ G+ S++ +IW M EY G + +++SFTCL Q Sbjct: 362 LELLNIARWPYIGPDLVSFNTILSAACELGDWSVIGQIWGRMKEYEGTKFDIVSFTCLIQ 421 Query: 180 Y 182 Y Sbjct: 422 Y 422 >ref|XP_007224863.1| hypothetical protein PRUPE_ppa022809mg [Prunus persica] gi|462421799|gb|EMJ26062.1| hypothetical protein PRUPE_ppa022809mg [Prunus persica] Length = 544 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/66 (42%), Positives = 42/66 (63%) Frame = +3 Query: 3 LEHLNRFNWVVNGPDMVSFNTLLAAACKRGNSSMVHRIWCIMEYAGLELNVISFTCLNQY 182 L+ L+ F W NGPD++SFNT+L+ ACK+ SM+ R+ ++ G++ N +S CL QY Sbjct: 345 LKLLDCFKWDENGPDVISFNTILSVACKQKKHSMIQRVLSRLKNGGVQPNAVSLNCLIQY 404 Query: 183 *IKQVK 200 K K Sbjct: 405 FCKVEK 410