BLASTX nr result
ID: Paeonia23_contig00042521
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00042521 (295 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABB55293.1| hypothetical protein 10.t00044 [Asparagus officin... 59 7e-07 >gb|ABB55293.1| hypothetical protein 10.t00044 [Asparagus officinalis] Length = 176 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/51 (50%), Positives = 40/51 (78%) Frame = +2 Query: 143 MDFKIEVLMYNGALDVEKLDL*VNRRESYFSVGRYTHKEKIRFACLKLDGY 295 +DFK+E+L+Y+G++DVE+LD + R E+YF++ Y+ KEKI F LKL G+ Sbjct: 109 IDFKVEILIYDGSVDVERLDDWIERMETYFTLYGYSSKEKIVFTTLKLSGH 159