BLASTX nr result
ID: Paeonia23_contig00042433
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00042433 (344 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002317482.1| pentatricopeptide repeat-containing family p... 65 1e-08 ref|XP_007021561.1| Tetratricopeptide repeat (TPR)-like superfam... 62 6e-08 ref|XP_002532249.1| pentatricopeptide repeat-containing protein,... 58 2e-06 emb|CBI20261.3| unnamed protein product [Vitis vinifera] 56 6e-06 ref|XP_002282646.1| PREDICTED: putative pentatricopeptide repeat... 56 6e-06 >ref|XP_002317482.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222860547|gb|EEE98094.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 433 Score = 65.1 bits (157), Expect = 1e-08 Identities = 32/66 (48%), Positives = 46/66 (69%), Gaps = 6/66 (9%) Frame = +2 Query: 2 EKGRIEEALCYFSEMTSKGMVPEPRTELLVNA------RVGESGKISSMNSDKTSRTSHR 163 +KGR+E+AL YF EM +KGMVPEPRT++L N+ + E G+ S+ N+D++ R+SH Sbjct: 362 DKGRVEDALRYFGEMENKGMVPEPRTKILCNSMNTRKQKEAEEGEKSAKNNDQSPRSSHE 421 Query: 164 RGKKFK 181 R K K Sbjct: 422 RNTKKK 427 >ref|XP_007021561.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative [Theobroma cacao] gi|508721189|gb|EOY13086.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative [Theobroma cacao] Length = 534 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/62 (50%), Positives = 40/62 (64%) Frame = +2 Query: 2 EKGRIEEALCYFSEMTSKGMVPEPRTELLVNARVGESGKISSMNSDKTSRTSHRRGKKFK 181 +KG IE+AL YF+EMTSKGMVPEPRTE+LVNA K+ +K + + GK + Sbjct: 466 DKGSIEDALSYFNEMTSKGMVPEPRTEILVNAM---KDKLKEQEGEKERKEPGKNGKSLR 522 Query: 182 SR 187 R Sbjct: 523 PR 524 >ref|XP_002532249.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223528067|gb|EEF30143.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 507 Score = 57.8 bits (138), Expect = 2e-06 Identities = 31/69 (44%), Positives = 44/69 (63%), Gaps = 7/69 (10%) Frame = +2 Query: 2 EKGRIEEALCYFSEMTSKGMVPEPRTELLVNA-------RVGESGKISSMNSDKTSRTSH 160 EKGRI +AL YF EMTSKGMV EPRTE+LV++ E G+ ++N K+ + H Sbjct: 439 EKGRINDALHYFGEMTSKGMVSEPRTEMLVSSMNMKLKDNDAEQGEKDAINGVKSLGSMH 498 Query: 161 RRGKKFKSR 187 +R ++ + R Sbjct: 499 KRRREIRVR 507 >emb|CBI20261.3| unnamed protein product [Vitis vinifera] Length = 509 Score = 55.8 bits (133), Expect = 6e-06 Identities = 32/65 (49%), Positives = 39/65 (60%), Gaps = 7/65 (10%) Frame = +2 Query: 2 EKGRIEEALCYFSEMTSKGMVPEPRTELLVNA-------RVGESGKISSMNSDKTSRTSH 160 +KGR+++AL YF +MT GMVPEPRT LLVNA R E + N + R S Sbjct: 441 DKGRMDDALSYFKQMTLMGMVPEPRTTLLVNAMNIKLKEREAEPEGKGARNKADSIRPST 500 Query: 161 RRGKK 175 RRGKK Sbjct: 501 RRGKK 505 >ref|XP_002282646.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15200-like [Vitis vinifera] Length = 546 Score = 55.8 bits (133), Expect = 6e-06 Identities = 32/65 (49%), Positives = 39/65 (60%), Gaps = 7/65 (10%) Frame = +2 Query: 2 EKGRIEEALCYFSEMTSKGMVPEPRTELLVNA-------RVGESGKISSMNSDKTSRTSH 160 +KGR+++AL YF +MT GMVPEPRT LLVNA R E + N + R S Sbjct: 478 DKGRMDDALSYFKQMTLMGMVPEPRTTLLVNAMNIKLKEREAEPEGKGARNKADSIRPST 537 Query: 161 RRGKK 175 RRGKK Sbjct: 538 RRGKK 542