BLASTX nr result
ID: Paeonia23_contig00042324
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00042324 (435 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004169043.1| PREDICTED: putative ribonuclease H protein A... 58 1e-06 >ref|XP_004169043.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Cucumis sativus] Length = 331 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/56 (44%), Positives = 35/56 (62%) Frame = -3 Query: 271 RAKFFVWCLAHRRLNTNDSRQRKIQHLTISPDCSILFKSDAETANHILFKCAFVRK 104 + KFF+W LA+R LNT++ Q+KIQ+ +SP L D ET +H+ C F RK Sbjct: 196 KVKFFLWSLAYRSLNTHEKLQKKIQNTLLSPSMCCLCAKDEETLDHLFLHCPFTRK 251