BLASTX nr result
ID: Paeonia23_contig00042241
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00042241 (229 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_003946934.1| conserved hypothetical protein, partial [Str... 65 1e-08 ref|WP_003038304.1| hypothetical protein [Streptococcus anginosu... 55 4e-08 ref|NP_738153.1| hypothetical protein CE1543 [Corynebacterium ef... 52 5e-07 ref|WP_004986320.1| conserved hypothetical protein, partial [Str... 57 4e-06 ref|WP_023583665.1| hypothetical protein [Proteus hauseri] gi|55... 56 6e-06 >ref|WP_003946934.1| conserved hypothetical protein, partial [Streptomyces albus] gi|291353151|gb|EFE80053.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces albus J1074] Length = 104 Score = 65.1 bits (157), Expect = 1e-08 Identities = 34/69 (49%), Positives = 36/69 (52%) Frame = +2 Query: 23 FARSPRYSLPDHLCRFRVRAARNSLEAFLGSMGSLTSP*TAPLHASPFMCRGFPYSTGYT 202 F R+PRYSLPDHL RFRVRAA F + M GF Y T YT Sbjct: 1 FTRTPRYSLPDHLSRFRVRAAMKLARGFSRQHRIIHFTTIGSASGLSHMYDGFTYRTAYT 60 Query: 203 LAPGQPPPG 229 L PGQPPPG Sbjct: 61 LTPGQPPPG 69 >ref|WP_003038304.1| hypothetical protein [Streptococcus anginosus] gi|383341230|gb|EID19495.1| hypothetical protein HMPREF1043_0707 [Streptococcus anginosus subsp. whileyi CCUG 39159] Length = 191 Score = 54.7 bits (130), Expect(2) = 4e-08 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = +3 Query: 3 AEFLNHGSLDRLGILYLTTCVGLGYGPLE 89 AEFLNH SLDRL ILYLTTCVGLGYG E Sbjct: 39 AEFLNHDSLDRLSILYLTTCVGLGYGQFE 67 Score = 28.5 bits (62), Expect(2) = 4e-08 Identities = 16/39 (41%), Positives = 18/39 (46%) Frame = +2 Query: 98 EAFLGSMGSLTSP*TAPLHASPFMCRGFPYSTGYTLAPG 214 +AFLGS+GS P GF Y YTL PG Sbjct: 71 DAFLGSIGSPDHPPCGRPSGLRHTAGGFTYRQPYTLRPG 109 >ref|NP_738153.1| hypothetical protein CE1543 [Corynebacterium efficiens YS-314] gi|499388034|ref|WP_011075501.1| hypothetical protein [Corynebacterium efficiens] gi|23493383|dbj|BAC18353.1| conserved hypothetical protein [Corynebacterium efficiens YS-314] Length = 261 Score = 52.0 bits (123), Expect(2) = 5e-07 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +3 Query: 3 AEFLNHGSLDRLGILYLTTCVGLGYGP 83 AEFLNH S +RL ILYLTTCVGLGYGP Sbjct: 111 AEFLNHSSPERLSILYLTTCVGLGYGP 137 Score = 27.3 bits (59), Expect(2) = 5e-07 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +1 Query: 91 LARGFSRQHGITDFT 135 +ARGFSRQ+ IT+FT Sbjct: 141 IARGFSRQYRITEFT 155 >ref|WP_004986320.1| conserved hypothetical protein, partial [Streptomyces ghanaensis] gi|291341603|gb|EFE68559.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672] Length = 91 Score = 56.6 bits (135), Expect = 4e-06 Identities = 29/47 (61%), Positives = 32/47 (68%) Frame = +2 Query: 89 NSLEAFLGSMGSLTSP*TAPLHASPFMCRGFPYSTGYTLAPGQPPPG 229 NSLEAFL S+GS TSP +A S + GF Y T YTL PGQPPPG Sbjct: 10 NSLEAFLDSIGSSTSPQSARHRVSDDVPGGFAYLTSYTLTPGQPPPG 56 >ref|WP_023583665.1| hypothetical protein [Proteus hauseri] gi|558646595|gb|EST57089.1| hypothetical protein K151_3366 [Proteus hauseri ZMd44] Length = 45 Score = 55.8 bits (133), Expect = 6e-06 Identities = 30/42 (71%), Positives = 34/42 (80%), Gaps = 2/42 (4%) Frame = -3 Query: 122 IPCCREKPLASFERP--VP*TDTGGQVENTEAIERTMVKELG 3 +PC +EKPL SF P VP TDTGGQVENT+A+ERT VKELG Sbjct: 1 MPCFQEKPL-SFRLPTIVPQTDTGGQVENTQALERTRVKELG 41