BLASTX nr result
ID: Paeonia23_contig00042013
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00042013 (245 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002300426.2| hypothetical protein POPTR_0001s38710g [Popu... 88 1e-15 gb|EXB52700.1| hypothetical protein L484_022477 [Morus notabilis] 84 2e-14 ref|XP_007022165.1| Interactor of constitutive active rops 1 iso... 84 2e-14 ref|XP_007022164.1| Interactor of constitutive active rops 1 iso... 84 2e-14 ref|XP_007149321.1| hypothetical protein PHAVU_005G060700g [Phas... 83 5e-14 ref|XP_002271827.2| PREDICTED: interactor of constitutive active... 83 5e-14 emb|CBI32925.3| unnamed protein product [Vitis vinifera] 83 5e-14 emb|CAN73256.1| hypothetical protein VITISV_002134 [Vitis vinifera] 83 5e-14 ref|XP_003543151.1| PREDICTED: interactor of constitutive active... 82 1e-13 ref|XP_006416740.1| hypothetical protein EUTSA_v10008080mg [Eutr... 81 1e-13 ref|XP_003546766.1| PREDICTED: interactor of constitutive active... 79 7e-13 gb|ACU21082.1| unknown [Glycine max] 79 7e-13 gb|AAF71812.1|AC013430_21 F3F9.6 [Arabidopsis thaliana] 79 9e-13 ref|NP_177964.2| ROP interactive partner 4 [Arabidopsis thaliana... 79 9e-13 ref|NP_564015.1| interactor of constitutive active ROPs 1 [Arabi... 78 1e-12 dbj|BAF01147.1| hypothetical protein [Arabidopsis thaliana] 78 1e-12 ref|XP_004243183.1| PREDICTED: interactor of constitutive active... 78 1e-12 ref|XP_006348373.1| PREDICTED: interactor of constitutive active... 77 2e-12 ref|XP_004488646.1| PREDICTED: interactor of constitutive active... 77 3e-12 ref|XP_004294109.1| PREDICTED: interactor of constitutive active... 77 3e-12 >ref|XP_002300426.2| hypothetical protein POPTR_0001s38710g [Populus trichocarpa] gi|550349202|gb|EEE85231.2| hypothetical protein POPTR_0001s38710g [Populus trichocarpa] Length = 364 Score = 88.2 bits (217), Expect = 1e-15 Identities = 48/79 (60%), Positives = 56/79 (70%) Frame = -1 Query: 239 LSLARAKGDETTLKLLQVGEELEASKLNATGLSGKLEAMEADKEALEAEMKKLRVQTEQW 60 +S A++K +E +LKL Q+GEELEASK NA L GKLEA E EALE EMKK+RVQTEQW Sbjct: 222 ISSAKSKEEEVSLKLGQLGEELEASKANAAQLKGKLEAAEGANEALETEMKKMRVQTEQW 281 Query: 59 RKXXXXXXXXXAGEVDMSG 3 RK AG V+MSG Sbjct: 282 RKAADAAAAVLAGGVEMSG 300 >gb|EXB52700.1| hypothetical protein L484_022477 [Morus notabilis] Length = 389 Score = 84.3 bits (207), Expect = 2e-14 Identities = 46/79 (58%), Positives = 57/79 (72%) Frame = -1 Query: 239 LSLARAKGDETTLKLLQVGEELEASKLNATGLSGKLEAMEADKEALEAEMKKLRVQTEQW 60 +S ARAK +E TL+L Q+GEELE K N T LS +L+++EA KEALEAEMKK+RV TEQW Sbjct: 254 ISSARAKEEEMTLRLSQLGEELETRKSNETRLSEQLKSVEAAKEALEAEMKKIRVHTEQW 313 Query: 59 RKXXXXXXXXXAGEVDMSG 3 RK AG V+M+G Sbjct: 314 RKAADAAAAVLAGGVEMNG 332 >ref|XP_007022165.1| Interactor of constitutive active rops 1 isoform 2 [Theobroma cacao] gi|508721793|gb|EOY13690.1| Interactor of constitutive active rops 1 isoform 2 [Theobroma cacao] Length = 386 Score = 84.3 bits (207), Expect = 2e-14 Identities = 45/79 (56%), Positives = 54/79 (68%) Frame = -1 Query: 239 LSLARAKGDETTLKLLQVGEELEASKLNATGLSGKLEAMEADKEALEAEMKKLRVQTEQW 60 +S A+ + +E +L QVGEELEA K NA L KL+AME KEALEAEMKKLRVQTEQW Sbjct: 244 VSAAKTREEEMASRLRQVGEELEARKTNAAQLKEKLQAMEGQKEALEAEMKKLRVQTEQW 303 Query: 59 RKXXXXXXXXXAGEVDMSG 3 RK +G V+M+G Sbjct: 304 RKAADAAAAILSGGVEMNG 322 >ref|XP_007022164.1| Interactor of constitutive active rops 1 isoform 1 [Theobroma cacao] gi|508721792|gb|EOY13689.1| Interactor of constitutive active rops 1 isoform 1 [Theobroma cacao] Length = 384 Score = 84.3 bits (207), Expect = 2e-14 Identities = 45/79 (56%), Positives = 54/79 (68%) Frame = -1 Query: 239 LSLARAKGDETTLKLLQVGEELEASKLNATGLSGKLEAMEADKEALEAEMKKLRVQTEQW 60 +S A+ + +E +L QVGEELEA K NA L KL+AME KEALEAEMKKLRVQTEQW Sbjct: 242 VSAAKTREEEMASRLRQVGEELEARKTNAAQLKEKLQAMEGQKEALEAEMKKLRVQTEQW 301 Query: 59 RKXXXXXXXXXAGEVDMSG 3 RK +G V+M+G Sbjct: 302 RKAADAAAAILSGGVEMNG 320 >ref|XP_007149321.1| hypothetical protein PHAVU_005G060700g [Phaseolus vulgaris] gi|561022585|gb|ESW21315.1| hypothetical protein PHAVU_005G060700g [Phaseolus vulgaris] Length = 380 Score = 82.8 bits (203), Expect = 5e-14 Identities = 45/79 (56%), Positives = 59/79 (74%) Frame = -1 Query: 242 ELSLARAKGDETTLKLLQVGEELEASKLNATGLSGKLEAMEADKEALEAEMKKLRVQTEQ 63 ++S A++K + TL+L Q+ EELEASK NA L+GKL+++EA+K+ LE+EMKKLRVQTEQ Sbjct: 237 KVSAAQSKEEGMTLQLDQLREELEASKANADKLNGKLKSVEAEKDGLESEMKKLRVQTEQ 296 Query: 62 WRKXXXXXXXXXAGEVDMS 6 WRK AG VDMS Sbjct: 297 WRKAADAAAAVLAGGVDMS 315 >ref|XP_002271827.2| PREDICTED: interactor of constitutive active ROPs 4-like [Vitis vinifera] Length = 346 Score = 82.8 bits (203), Expect = 5e-14 Identities = 45/80 (56%), Positives = 55/80 (68%) Frame = -1 Query: 242 ELSLARAKGDETTLKLLQVGEELEASKLNATGLSGKLEAMEADKEALEAEMKKLRVQTEQ 63 E+ L R K +E L+L Q+GE+L+A+K N L KLEA+E KEALEAEMKKLRVQTEQ Sbjct: 202 EIVLVRTKEEEMALRLSQLGEDLKANKANEAQLKEKLEAVEGVKEALEAEMKKLRVQTEQ 261 Query: 62 WRKXXXXXXXXXAGEVDMSG 3 WRK AG V+M+G Sbjct: 262 WRKAADAAAAVLAGGVEMNG 281 >emb|CBI32925.3| unnamed protein product [Vitis vinifera] Length = 362 Score = 82.8 bits (203), Expect = 5e-14 Identities = 45/80 (56%), Positives = 55/80 (68%) Frame = -1 Query: 242 ELSLARAKGDETTLKLLQVGEELEASKLNATGLSGKLEAMEADKEALEAEMKKLRVQTEQ 63 E+ L R K +E L+L Q+GE+L+A+K N L KLEA+E KEALEAEMKKLRVQTEQ Sbjct: 218 EIVLVRTKEEEMALRLSQLGEDLKANKANEAQLKEKLEAVEGVKEALEAEMKKLRVQTEQ 277 Query: 62 WRKXXXXXXXXXAGEVDMSG 3 WRK AG V+M+G Sbjct: 278 WRKAADAAAAVLAGGVEMNG 297 >emb|CAN73256.1| hypothetical protein VITISV_002134 [Vitis vinifera] Length = 376 Score = 82.8 bits (203), Expect = 5e-14 Identities = 45/80 (56%), Positives = 55/80 (68%) Frame = -1 Query: 242 ELSLARAKGDETTLKLLQVGEELEASKLNATGLSGKLEAMEADKEALEAEMKKLRVQTEQ 63 E+ L R K +E L+L Q+GE+L+A+K N L KLEA+E KEALEAEMKKLRVQTEQ Sbjct: 232 EIVLVRTKEEEMALRLSQLGEDLKANKANEAQLKEKLEAVEGVKEALEAEMKKLRVQTEQ 291 Query: 62 WRKXXXXXXXXXAGEVDMSG 3 WRK AG V+M+G Sbjct: 292 WRKAADAAAAVLAGGVEMNG 311 >ref|XP_003543151.1| PREDICTED: interactor of constitutive active ROPs 4-like isoformX1 [Glycine max] gi|356549542|ref|XP_003543152.1| PREDICTED: interactor of constitutive active ROPs 4-like isoformX2 [Glycine max] gi|571500672|ref|XP_006594682.1| PREDICTED: interactor of constitutive active ROPs 4-like isoform X3 [Glycine max] gi|571500676|ref|XP_006594683.1| PREDICTED: interactor of constitutive active ROPs 4-like isoform X4 [Glycine max] gi|571500679|ref|XP_006594684.1| PREDICTED: interactor of constitutive active ROPs 4-like isoform X5 [Glycine max] gi|571500682|ref|XP_006594685.1| PREDICTED: interactor of constitutive active ROPs 4-like isoform X6 [Glycine max] gi|571500686|ref|XP_006594686.1| PREDICTED: interactor of constitutive active ROPs 4-like isoform X7 [Glycine max] Length = 377 Score = 81.6 bits (200), Expect = 1e-13 Identities = 46/79 (58%), Positives = 55/79 (69%) Frame = -1 Query: 242 ELSLARAKGDETTLKLLQVGEELEASKLNATGLSGKLEAMEADKEALEAEMKKLRVQTEQ 63 ++S A+ K +E TL+L Q+ EELEASK N L KL++MEA KE LE+EMKKLRVQTEQ Sbjct: 234 KVSAAQTKEEEMTLQLNQLREELEASKANGDKLDEKLKSMEARKEGLESEMKKLRVQTEQ 293 Query: 62 WRKXXXXXXXXXAGEVDMS 6 WRK AG VDMS Sbjct: 294 WRKAADAAAAVLAGGVDMS 312 >ref|XP_006416740.1| hypothetical protein EUTSA_v10008080mg [Eutrema salsugineum] gi|557094511|gb|ESQ35093.1| hypothetical protein EUTSA_v10008080mg [Eutrema salsugineum] Length = 348 Score = 81.3 bits (199), Expect = 1e-13 Identities = 45/80 (56%), Positives = 52/80 (65%) Frame = -1 Query: 242 ELSLARAKGDETTLKLLQVGEELEASKLNATGLSGKLEAMEADKEALEAEMKKLRVQTEQ 63 E+S RA DE K+ Q+GEELE S+ L KLE+ME KEALEAEMKKLRVQTEQ Sbjct: 208 EMSNVRANEDEMASKVGQIGEELEESRAKTAQLKEKLESMEEAKEALEAEMKKLRVQTEQ 267 Query: 62 WRKXXXXXXXXXAGEVDMSG 3 WRK AGE +M+G Sbjct: 268 WRKAADAAAAVLAGEFEMNG 287 >ref|XP_003546766.1| PREDICTED: interactor of constitutive active ROPs 4 isoformX1 [Glycine max] gi|356556918|ref|XP_003546767.1| PREDICTED: interactor of constitutive active ROPs 4 isoformX2 [Glycine max] gi|571521467|ref|XP_006598164.1| PREDICTED: interactor of constitutive active ROPs 4 isoform X3 [Glycine max] gi|571521471|ref|XP_006598165.1| PREDICTED: interactor of constitutive active ROPs 4 isoform X4 [Glycine max] gi|571521476|ref|XP_006598166.1| PREDICTED: interactor of constitutive active ROPs 4 isoform X5 [Glycine max] Length = 380 Score = 79.0 bits (193), Expect = 7e-13 Identities = 44/79 (55%), Positives = 55/79 (69%) Frame = -1 Query: 242 ELSLARAKGDETTLKLLQVGEELEASKLNATGLSGKLEAMEADKEALEAEMKKLRVQTEQ 63 ++S A+ K + TL+L Q+ EELE SK NA L KL+++EA+KE LE+EMKKLRVQTEQ Sbjct: 237 KVSAAQTKEEGMTLQLNQLREELETSKANADKLDEKLKSVEAEKEGLESEMKKLRVQTEQ 296 Query: 62 WRKXXXXXXXXXAGEVDMS 6 WRK AG VDMS Sbjct: 297 WRKAADAAAAVLAGGVDMS 315 >gb|ACU21082.1| unknown [Glycine max] Length = 161 Score = 79.0 bits (193), Expect = 7e-13 Identities = 44/79 (55%), Positives = 55/79 (69%) Frame = -1 Query: 242 ELSLARAKGDETTLKLLQVGEELEASKLNATGLSGKLEAMEADKEALEAEMKKLRVQTEQ 63 ++S A+ K + TL+L Q+ EELE SK NA L KL+++EA+KE LE+EMKKLRVQTEQ Sbjct: 18 KVSAAQTKEEGMTLQLNQLREELETSKANADKLDEKLKSVEAEKEGLESEMKKLRVQTEQ 77 Query: 62 WRKXXXXXXXXXAGEVDMS 6 WRK AG VDMS Sbjct: 78 WRKAADAAAAVLAGGVDMS 96 >gb|AAF71812.1|AC013430_21 F3F9.6 [Arabidopsis thaliana] Length = 326 Score = 78.6 bits (192), Expect = 9e-13 Identities = 42/80 (52%), Positives = 52/80 (65%) Frame = -1 Query: 242 ELSLARAKGDETTLKLLQVGEELEASKLNATGLSGKLEAMEADKEALEAEMKKLRVQTEQ 63 E+S A+AK DE K+ Q+GEELE S L KLE++E KE LEAEMKKL+VQTEQ Sbjct: 195 EMSCAKAKEDEIASKVSQIGEELEESNETTAKLKKKLESVEEAKETLEAEMKKLKVQTEQ 254 Query: 62 WRKXXXXXXXXXAGEVDMSG 3 WRK +G V+M+G Sbjct: 255 WRKAADAAAAVLSGGVEMNG 274 >ref|NP_177964.2| ROP interactive partner 4 [Arabidopsis thaliana] gi|374095407|sp|Q9M9F9.2|ICR4_ARATH RecName: Full=Interactor of constitutive active ROPs 4; AltName: Full=ROP-interactive partner 4 gi|332197984|gb|AEE36105.1| ROP interactive partner 4 [Arabidopsis thaliana] Length = 324 Score = 78.6 bits (192), Expect = 9e-13 Identities = 42/80 (52%), Positives = 52/80 (65%) Frame = -1 Query: 242 ELSLARAKGDETTLKLLQVGEELEASKLNATGLSGKLEAMEADKEALEAEMKKLRVQTEQ 63 E+S A+AK DE K+ Q+GEELE S L KLE++E KE LEAEMKKL+VQTEQ Sbjct: 193 EMSCAKAKEDEIASKVSQIGEELEESNETTAKLKKKLESVEEAKETLEAEMKKLKVQTEQ 252 Query: 62 WRKXXXXXXXXXAGEVDMSG 3 WRK +G V+M+G Sbjct: 253 WRKAADAAAAVLSGGVEMNG 272 >ref|NP_564015.1| interactor of constitutive active ROPs 1 [Arabidopsis thaliana] gi|42571515|ref|NP_973848.1| interactor of constitutive active ROPs 1 [Arabidopsis thaliana] gi|51316870|sp|Q8LE98.1|ICR1_ARATH RecName: Full=Interactor of constitutive active ROPs 1; AltName: Full=ROP-interactive partner 1 gi|21553674|gb|AAM62767.1| unknown [Arabidopsis thaliana] gi|89000951|gb|ABD59065.1| At1g17140 [Arabidopsis thaliana] gi|332191426|gb|AEE29547.1| interactor of constitutive active ROPs 1 [Arabidopsis thaliana] gi|332191427|gb|AEE29548.1| interactor of constitutive active ROPs 1 [Arabidopsis thaliana] Length = 344 Score = 78.2 bits (191), Expect = 1e-12 Identities = 41/80 (51%), Positives = 52/80 (65%) Frame = -1 Query: 242 ELSLARAKGDETTLKLLQVGEELEASKLNATGLSGKLEAMEADKEALEAEMKKLRVQTEQ 63 E+S +A DE K+ ++GEELE S+ L KLE+ME K+ALEAEMKKLRVQTEQ Sbjct: 206 EISNVKANEDEMVSKVSRIGEELEESRAKTAHLKEKLESMEEAKDALEAEMKKLRVQTEQ 265 Query: 62 WRKXXXXXXXXXAGEVDMSG 3 WRK +GE +M+G Sbjct: 266 WRKAADAAAAVLSGEFEMNG 285 >dbj|BAF01147.1| hypothetical protein [Arabidopsis thaliana] Length = 344 Score = 78.2 bits (191), Expect = 1e-12 Identities = 41/80 (51%), Positives = 52/80 (65%) Frame = -1 Query: 242 ELSLARAKGDETTLKLLQVGEELEASKLNATGLSGKLEAMEADKEALEAEMKKLRVQTEQ 63 E+S +A DE K+ ++GEELE S+ L KLE+ME K+ALEAEMKKLRVQTEQ Sbjct: 206 EISNVKANEDEMVSKVSRIGEELEESRAKTAHLKEKLESMEEAKDALEAEMKKLRVQTEQ 265 Query: 62 WRKXXXXXXXXXAGEVDMSG 3 WRK +GE +M+G Sbjct: 266 WRKAADAAAAVLSGEFEMNG 285 >ref|XP_004243183.1| PREDICTED: interactor of constitutive active ROPs 4-like isoform 1 [Solanum lycopersicum] gi|460395222|ref|XP_004243184.1| PREDICTED: interactor of constitutive active ROPs 4-like isoform 2 [Solanum lycopersicum] Length = 370 Score = 77.8 bits (190), Expect = 1e-12 Identities = 41/63 (65%), Positives = 47/63 (74%) Frame = -1 Query: 242 ELSLARAKGDETTLKLLQVGEELEASKLNATGLSGKLEAMEADKEALEAEMKKLRVQTEQ 63 E+S +AK DET+LKL QV +ELE SK + + KLEA E KEALE EMKKLRVQTEQ Sbjct: 225 EISSLKAKEDETSLKLNQVAQELETSKNDGVNIKEKLEATEKAKEALENEMKKLRVQTEQ 284 Query: 62 WRK 54 WRK Sbjct: 285 WRK 287 >ref|XP_006348373.1| PREDICTED: interactor of constitutive active ROPs 1-like [Solanum tuberosum] Length = 375 Score = 77.4 bits (189), Expect = 2e-12 Identities = 42/63 (66%), Positives = 47/63 (74%) Frame = -1 Query: 242 ELSLARAKGDETTLKLLQVGEELEASKLNATGLSGKLEAMEADKEALEAEMKKLRVQTEQ 63 E+S +AK DET+LKL QV +ELE SK + L KLEA E KEALE EMKKLRVQTEQ Sbjct: 230 EISSTKAKEDETSLKLDQVTQELETSKNDGLNLKEKLEATEKAKEALENEMKKLRVQTEQ 289 Query: 62 WRK 54 WRK Sbjct: 290 WRK 292 >ref|XP_004488646.1| PREDICTED: interactor of constitutive active ROPs 1-like isoform X1 [Cicer arietinum] gi|502087801|ref|XP_004488647.1| PREDICTED: interactor of constitutive active ROPs 1-like isoform X2 [Cicer arietinum] gi|502087804|ref|XP_004488648.1| PREDICTED: interactor of constitutive active ROPs 1-like isoform X3 [Cicer arietinum] gi|502087807|ref|XP_004488649.1| PREDICTED: interactor of constitutive active ROPs 1-like isoform X4 [Cicer arietinum] Length = 364 Score = 76.6 bits (187), Expect = 3e-12 Identities = 41/80 (51%), Positives = 54/80 (67%) Frame = -1 Query: 242 ELSLARAKGDETTLKLLQVGEELEASKLNATGLSGKLEAMEADKEALEAEMKKLRVQTEQ 63 ++++ K +E TLKL Q+ EE E SK N L+ KL+ +E +KE LE+EMKKLRVQTEQ Sbjct: 217 KVTVFETKDEEMTLKLKQLCEEFEVSKGNEEKLNEKLKFLEGEKEGLESEMKKLRVQTEQ 276 Query: 62 WRKXXXXXXXXXAGEVDMSG 3 WRK AGE+DM+G Sbjct: 277 WRKAADAAAAVLAGEMDMNG 296 >ref|XP_004294109.1| PREDICTED: interactor of constitutive active ROPs 1-like isoform 1 [Fragaria vesca subsp. vesca] gi|470115862|ref|XP_004294110.1| PREDICTED: interactor of constitutive active ROPs 1-like isoform 2 [Fragaria vesca subsp. vesca] Length = 379 Score = 76.6 bits (187), Expect = 3e-12 Identities = 44/79 (55%), Positives = 52/79 (65%) Frame = -1 Query: 239 LSLARAKGDETTLKLLQVGEELEASKLNATGLSGKLEAMEADKEALEAEMKKLRVQTEQW 60 +S A K E LK + EELEASK NA LS KL+A+E KEALEAEMKK+RVQTEQW Sbjct: 238 ISTAEVKEKEMALKSSKFEEELEASKANAAELSEKLKAIEEVKEALEAEMKKMRVQTEQW 297 Query: 59 RKXXXXXXXXXAGEVDMSG 3 +K AG V+M+G Sbjct: 298 KKAADAAATILAGGVEMNG 316