BLASTX nr result
ID: Paeonia23_contig00041726
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00041726 (321 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006464706.1| PREDICTED: uncharacterized protein LOC102611... 57 3e-06 ref|XP_006451944.1| hypothetical protein CICLE_v10008646mg [Citr... 57 3e-06 ref|XP_006451942.1| hypothetical protein CICLE_v10008646mg [Citr... 57 3e-06 ref|XP_002317517.2| hypothetical protein POPTR_0011s12440g [Popu... 56 6e-06 ref|XP_007021317.1| Peroxisomal membrane 22 kDa family protein i... 56 6e-06 ref|XP_007021315.1| Peroxisomal membrane 22 kDa family protein i... 56 6e-06 gb|EXB50359.1| Peroxisomal membrane protein 2 [Morus notabilis] 55 8e-06 >ref|XP_006464706.1| PREDICTED: uncharacterized protein LOC102611604 [Citrus sinensis] Length = 365 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/43 (65%), Positives = 28/43 (65%) Frame = -3 Query: 319 WVDCVELIWVTILSTLSNEKSEARIXXXXXXXXXXXXSIGPPE 191 WVDCVELIWVTILST SNEKSEARI I PPE Sbjct: 322 WVDCVELIWVTILSTYSNEKSEARIAEAPAEVKPCLPDISPPE 364 >ref|XP_006451944.1| hypothetical protein CICLE_v10008646mg [Citrus clementina] gi|557555170|gb|ESR65184.1| hypothetical protein CICLE_v10008646mg [Citrus clementina] Length = 380 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/43 (65%), Positives = 28/43 (65%) Frame = -3 Query: 319 WVDCVELIWVTILSTLSNEKSEARIXXXXXXXXXXXXSIGPPE 191 WVDCVELIWVTILST SNEKSEARI I PPE Sbjct: 325 WVDCVELIWVTILSTYSNEKSEARIAEAPAEVKPCLPDISPPE 367 >ref|XP_006451942.1| hypothetical protein CICLE_v10008646mg [Citrus clementina] gi|567919874|ref|XP_006451943.1| hypothetical protein CICLE_v10008646mg [Citrus clementina] gi|567919880|ref|XP_006451946.1| hypothetical protein CICLE_v10008646mg [Citrus clementina] gi|557555168|gb|ESR65182.1| hypothetical protein CICLE_v10008646mg [Citrus clementina] gi|557555169|gb|ESR65183.1| hypothetical protein CICLE_v10008646mg [Citrus clementina] gi|557555172|gb|ESR65186.1| hypothetical protein CICLE_v10008646mg [Citrus clementina] Length = 368 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/43 (65%), Positives = 28/43 (65%) Frame = -3 Query: 319 WVDCVELIWVTILSTLSNEKSEARIXXXXXXXXXXXXSIGPPE 191 WVDCVELIWVTILST SNEKSEARI I PPE Sbjct: 325 WVDCVELIWVTILSTYSNEKSEARIAEAPAEVKPCLPDISPPE 367 >ref|XP_002317517.2| hypothetical protein POPTR_0011s12440g [Populus trichocarpa] gi|550328227|gb|EEE98129.2| hypothetical protein POPTR_0011s12440g [Populus trichocarpa] Length = 370 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/43 (67%), Positives = 29/43 (67%) Frame = -3 Query: 319 WVDCVELIWVTILSTLSNEKSEARIXXXXXXXXXXXXSIGPPE 191 WVDCVELIWVTILST SNEKSEARI SIG PE Sbjct: 327 WVDCVELIWVTILSTYSNEKSEARISEATVEASSSSLSIGSPE 369 >ref|XP_007021317.1| Peroxisomal membrane 22 kDa family protein isoform 3 [Theobroma cacao] gi|508720945|gb|EOY12842.1| Peroxisomal membrane 22 kDa family protein isoform 3 [Theobroma cacao] Length = 391 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/45 (60%), Positives = 29/45 (64%) Frame = -3 Query: 319 WVDCVELIWVTILSTLSNEKSEARIXXXXXXXXXXXXSIGPPESK 185 WVDCVELIWVTILST SNEKSEARI +GP E + Sbjct: 344 WVDCVELIWVTILSTYSNEKSEARIAEAPAEANSSLPPVGPSEEQ 388 >ref|XP_007021315.1| Peroxisomal membrane 22 kDa family protein isoform 1 [Theobroma cacao] gi|590608627|ref|XP_007021316.1| Peroxisomal membrane 22 kDa family protein isoform 1 [Theobroma cacao] gi|508720943|gb|EOY12840.1| Peroxisomal membrane 22 kDa family protein isoform 1 [Theobroma cacao] gi|508720944|gb|EOY12841.1| Peroxisomal membrane 22 kDa family protein isoform 1 [Theobroma cacao] Length = 386 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/45 (60%), Positives = 29/45 (64%) Frame = -3 Query: 319 WVDCVELIWVTILSTLSNEKSEARIXXXXXXXXXXXXSIGPPESK 185 WVDCVELIWVTILST SNEKSEARI +GP E + Sbjct: 339 WVDCVELIWVTILSTYSNEKSEARIAEAPAEANSSLPPVGPSEEQ 383 >gb|EXB50359.1| Peroxisomal membrane protein 2 [Morus notabilis] Length = 393 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/43 (62%), Positives = 29/43 (67%) Frame = -3 Query: 319 WVDCVELIWVTILSTLSNEKSEARIXXXXXXXXXXXXSIGPPE 191 WVDCVELIWVTILST SNEKSEARI ++ PPE Sbjct: 331 WVDCVELIWVTILSTYSNEKSEARISEAPVEVNLISSNVTPPE 373